KEGG   Pectobacterium sp. SCC3193: W5S_0590Help
Entry
W5S_0590          CDS       T02514                                 

Definition
Methylisocitrate lyase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:pec00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649288..650220
Genome map
AA seq 310 aa AA seqDB search
MSIILPHHAPTDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFQAITEIFDVTTRPLIFDGDTGGQTEHLS
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILAFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDQCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctcatcatgccccaacggattcatataaggggtgtacgccaggc
tcacgtcgtagtgcactccgtgaattattgcagcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgctttattaatcgagcaagctgcttatgaagatggcgatatt
cattatcaatttgatgcgttttggtctagctcactcaccgattccactttgcgtggaaaa
cccgatacggagttagtagacatcagtcatcgttttcaagcgattacggaaatatttgat
gttactacccgcccattaatttttgacggtgatactggcgggcaaactgaacatttatcc
caccggatccgtgccgccgaaaatctgggtatttccgccatgattatcgaagataaaacc
ggcctgaaaaagaactctttatttggtaatgatgtaaagcaaacgcaggcttctgtagcg
gatttttgcgaaaaaattacgactgcaaaaaaagcacaactgacgcccgagtttatgtta
atcgcgcgtattgagagcctgattctggacgtcggtatggaagatgcgataaaccgtgcc
ttacattatgctgatgccggtgccgatggcattatgatccacagtcggcataagaaccct
tctgagattttagctttcgctaaacaattccgcgatcattatccacatttacctttggtt
tgtgttcctaccagttttaacgatattactttcgatcaactgattgatggtggattcaat
attgttatttacgcaaaccatatgttacgtgcggcttatcctgcgatgaaatcaatttta
ccagaaatcctcaagcatggtcgaacgctggaagttgaggatcaatgcatgtcgataaaa
gatattctggatcttatacccggcacgcgatag

DBGET integrated database retrieval system