KEGG   Pectobacterium sp. SCC3193: W5S_0590Help
Entry
W5S_0590          CDS       T02514                                 

Definition
Methylisocitrate lyase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    W5S_0590
Enzymes [BR:pec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     W5S_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649288..650220
Genome map
AA seq 310 aa AA seqDB search
MSIILPHHAPTDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFQAITEIFDVTTRPLIFDGDTGGQTEHLS
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILAFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDQCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctcatcatgccccaacggattcatataaggggtgtacgccaggc
tcacgtcgtagtgcactccgtgaattattgcagcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgctttattaatcgagcaagctgcttatgaagatggcgatatt
cattatcaatttgatgcgttttggtctagctcactcaccgattccactttgcgtggaaaa
cccgatacggagttagtagacatcagtcatcgttttcaagcgattacggaaatatttgat
gttactacccgcccattaatttttgacggtgatactggcgggcaaactgaacatttatcc
caccggatccgtgccgccgaaaatctgggtatttccgccatgattatcgaagataaaacc
ggcctgaaaaagaactctttatttggtaatgatgtaaagcaaacgcaggcttctgtagcg
gatttttgcgaaaaaattacgactgcaaaaaaagcacaactgacgcccgagtttatgtta
atcgcgcgtattgagagcctgattctggacgtcggtatggaagatgcgataaaccgtgcc
ttacattatgctgatgccggtgccgatggcattatgatccacagtcggcataagaaccct
tctgagattttagctttcgctaaacaattccgcgatcattatccacatttacctttggtt
tgtgttcctaccagttttaacgatattactttcgatcaactgattgatggtggattcaat
attgttatttacgcaaaccatatgttacgtgcggcttatcctgcgatgaaatcaatttta
ccagaaatcctcaagcatggtcgaacgctggaagttgaggatcaatgcatgtcgataaaa
gatattctggatcttatacccggcacgcgatag

DBGET integrated database retrieval system