KEGG   Pectobacterium sp. SCC3193: W5S_0725Help
Entry
W5S_0725          CDS       T02514                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    W5S_0725
Enzymes [BR:pec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     W5S_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
793342..794670
Genome map
AA seq 442 aa AA seqDB search
MFLIQEIIRKKRDGKALSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALT
LAMRDSGTVLDWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGLDIFPNDDHFRRIIQQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEQLAQAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLAGEHRNPRLYDVTMALCSEMLLAGGLASSADDAHSRL
QAVLDNGKAADVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFAAREGIVTAMDTRALG
MAVVSLGGGRRQATDTIDYSVGLDSMISLGERVDAQRPLAVIHANTEAQWQQAANEVRAA
IQLGDTAPEKTPMVYRRVSTEV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaagaaattattcgtaagaagcgtgatggaaaagcgctgagtgaagaa
gaaatccgcttttttatcaacggtattcgtgacaacaccgtctctgaaggccagatcgcc
gctctcgcgatgaccatttattttcacgacatgtcgatggacgagcgggtggcgctgacg
ttggcgatgcgtgattctggcacggtgctggactggaagagcctgaacctgaacggcccg
ctggtggacaaacactctaccggtggcgtgggcgatgtgacctcgctgatgctagggcca
atggtcgccgcctgtggggggtatgtcccgatgatctctggacgcggcttagggcatacc
ggtggcacgttagataagctagaagcgatacctggactggatatttttccgaacgatgac
cattttcgtcgcatcatccagcaggttggcgtcgcgattattgggcagacctcatcgctg
gctccggcggataaacgcttttacgccacgcgtgacattaccgccactgttgattcgatc
ccattgatcaccgcgtcgattctggcgaaaaaattggccgaaggactggatgcgttagtg
atggacgtcaaagtcggttccggggcgtttatgccgacctatgaactgtccgaacaactg
gcgcaggcgattgtcggcgtggcgaataatgcgggatgtcgcaccagcgccttgctgacg
gacatgaatcaggtgctggcctccagcgcggggaatgcgctggaagtgcgagaagccgtg
cgcttcctggcgggagagcaccgtaatccgcgtctgtatgatgttactatggcgttatgt
agcgagatgctgctagcgggcgggctggcaagctcggcggacgacgcacattcacgtttg
caggcggtgttggataacggcaaagccgccgatgtctttggccgcatggttgctgcacag
cgtggaccgggggattttgtcgaacactacgatcgctacctgccggtggcgacgttaagt
aagccggtgttcgcagcgcgtgaaggcattgtgaccgcgatggatacccgtgcgttggga
atggcagtcgtatcgctgggcggcggacgccgtcaggccacagatacgatcgattacagt
gtcggtctggatagcatgattagtttgggtgagcgcgttgacgcacagcgaccgctggcg
gtgatccacgccaatacagaagcgcaatggcagcaggcggcgaatgaagtccgagccgcg
atccaactgggcgacacggcaccggaaaagaccccgatggtttatcgtcgggtgagtacg
gaagtgtga

DBGET integrated database retrieval system