KEGG   Pectobacterium sp. SCC3193: W5S_0769Help
Entry
W5S_0769          CDS       T02514                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pec  Pectobacterium sp. SCC3193
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837483..838166
Genome map
AA seq 227 aa AA seqDB search
MATATNFAHADDTAIQQTLTRLDMQGAEILPSPMAGMKTVITESGVLYISEDGKHLLQGP
LYDVSGTMPVNTTNKILIGKMDALQEQMIVYKAAQEKHVITVFTDITCGYCHKLHEQMKD
YNALGITVRYLAFPRQGMKSQAAKDMQSIWCVADRNKAFDNAMKSEAISPATCKTDIAAH
YQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacggcgaccaactttgctcacgccgacgataccgcaatccagcagacgctgacg
cgtctggatatgcagggggcagaaattctgccttcgccgatggcgggtatgaaaaccgtt
attactgagagcggcgtgctgtacatcagcgaagacggcaaacatttgctacaaggcccg
ctttatgatgtgagcggcaccatgccggtcaacaccaccaataaaatcctgatcggcaag
atggatgcgttacaggagcagatgattgtttataaagccgcgcaggaaaaacatgtgatt
accgttttcaccgacatcacctgcggttactgccacaaactgcatgagcagatgaaagat
tacaatgcgttgggtatcaccgtgcgctatctggccttcccgcgtcagggcatgaaatct
caggcagcgaaagatatgcagtccatctggtgcgtggccgatcgcaataaagcgtttgat
aacgcgatgaagagcgaagcgatctcgccagcaacgtgcaaaaccgatatcgccgcgcat
taccaactgggtatccagtttggcgtgcagggcaccccagccatcgtgctgcaagacggc
atggttgtaccgggatatcaagggccgaaagagatgttggcaatgttggaagcacacaaa
gcctcgaaaaaaactggcggttga

DBGET integrated database retrieval system