KEGG   Pectobacterium sp. SCC3193: W5S_0769Help
Entry
W5S_0769          CDS       T02514                                 

Definition
(RefSeq) Thiol:disulfide interchange protein DsbC
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pec  Pectobacterium sp. SCC3193
Brite
Enzymes [BR:pec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     W5S_0769
Secretion system [BR:pec02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   W5S_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
837483..838166
Genome map
AA seq 227 aa AA seqDB search
MATATNFAHADDTAIQQTLTRLDMQGAEILPSPMAGMKTVITESGVLYISEDGKHLLQGP
LYDVSGTMPVNTTNKILIGKMDALQEQMIVYKAAQEKHVITVFTDITCGYCHKLHEQMKD
YNALGITVRYLAFPRQGMKSQAAKDMQSIWCVADRNKAFDNAMKSEAISPATCKTDIAAH
YQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacggcgaccaactttgctcacgccgacgataccgcaatccagcagacgctgacg
cgtctggatatgcagggggcagaaattctgccttcgccgatggcgggtatgaaaaccgtt
attactgagagcggcgtgctgtacatcagcgaagacggcaaacatttgctacaaggcccg
ctttatgatgtgagcggcaccatgccggtcaacaccaccaataaaatcctgatcggcaag
atggatgcgttacaggagcagatgattgtttataaagccgcgcaggaaaaacatgtgatt
accgttttcaccgacatcacctgcggttactgccacaaactgcatgagcagatgaaagat
tacaatgcgttgggtatcaccgtgcgctatctggccttcccgcgtcagggcatgaaatct
caggcagcgaaagatatgcagtccatctggtgcgtggccgatcgcaataaagcgtttgat
aacgcgatgaagagcgaagcgatctcgccagcaacgtgcaaaaccgatatcgccgcgcat
taccaactgggtatccagtttggcgtgcagggcaccccagccatcgtgctgcaagacggc
atggttgtaccgggatatcaagggccgaaagagatgttggcaatgttggaagcacacaaa
gcctcgaaaaaaactggcggttga

DBGET integrated database retrieval system