KEGG   Pectobacterium sp. SCC3193: W5S_1138Help
Entry
W5S_1138          CDS       T02514                                 

Definition
Pectinesterase A
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pec00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1245110..1246216)
Genome map
AA seq 368 aa AA seqDB search
MINASHFGKTLTLAMLISSPWALAQAADYNALVSANATDAKAYKTITEAIASAPADSSPF
VIYVKNGVYHERLTITRPNIHLQGESRDGTVIAATTAAGMLKPDGSKWGTYGSNTVKVDA
PDFSARSLTISNDFDYPANQAKASDDPTKLKDSQAVALLVAENSDRAWFHDVSLTGYQDT
LYVKGGRSFFSKCRISGTVDFIFGNGTALFDDCDIVARNRTDVKDQPLGYLTAPSTDIKQ
KYGLVIINSRVIKEKDVPAKSYGLGRPWHPTTTFEDGRYADPNAIGQTVILNTSMDDHIY
GWDKMSGKDKQGEKIWFHPQDSRFFEYKSSGTGAEKNEQRRQLSEAEAAEYTTDKVLAGW
VPTAPKGK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcctcacacttcggcaagacgctgactttagccatgttaatttcctcacct
tgggcgttagcacaggcagccgactacaatgcgctggtttccgccaatgcaacggacgcc
aaagcctataaaaccattactgaggctatcgccagcgccccggcagacagttccccattt
gttatctatgtgaaaaatggcgtgtaccacgagcgcctcacgattacgcgccccaacatc
catctacaaggcgaaagtcgtgacggtacagtgatcgccgcaaccaccgccgctggaatg
ctcaaacccgatggcagcaaatggggaacctatggcagcaacacggtgaaagtcgatgca
cccgatttcagcgcccgttcgctaaccatcagcaacgatttcgattacccagccaatcag
gccaaagccagtgatgacccgaccaaattaaaagattcgcaggccgttgcgctgctggtt
gccgaaaatagcgatcgtgcgtggttccatgatgtcagcctgaccggctaccaggacacg
ctgtatgtgaaaggtgggcgcagcttcttctcaaaatgccgtatcagcggcaccgttgat
ttcatctttggcaacggcactgcgctgtttgacgattgtgacattgtcgctcgtaatcgt
accgacgtgaaagatcaaccacttggttacctcaccgcccccagcactgacattaagcaa
aaatatggtttggtcattattaatagccgggtgattaaagagaaagatgtgcccgcaaaa
agctatggtttgggccgcccttggcacccaacaaccacctttgaggacggtcgttatgcc
gatcctaacgccatcggccagaccgttatcctgaacaccagcatggacgatcacatctat
ggctgggacaaaatgtcaggcaaagataaacaaggcgaaaaaatctggttccatccgcag
gactcgcgcttttttgagtacaaatctagcggtactggggcagagaaaaacgagcagcgc
cgtcagctaagcgaagcggaggcggcagaatacaccacagataaggtattagcaggttgg
gttcctactgcgcctaaagggaaataa

DBGET integrated database retrieval system