KEGG   Pectobacterium parmentieri SCC3193: W5S_1375Help
Entry
W5S_1375          CDS       T02514                                 

Definition
(GenBank) putative aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00220  Arginine biosynthesis
pec00250  Alanine, aspartate and glutamate metabolism
pec00290  Valine, leucine and isoleucine biosynthesis
pec01100  Metabolic pathways
pec01110  Biosynthesis of secondary metabolites
pec01130  Biosynthesis of antibiotics
pec01210  2-Oxocarboxylic acid metabolism
pec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W5S_1375
   00290 Valine, leucine and isoleucine biosynthesis
    W5S_1375
   00220 Arginine biosynthesis
    W5S_1375
Enzymes [BR:pec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     W5S_1375
    2.6.1.66  valine---pyruvate transaminase
     W5S_1375
Amino acid related enzymes [BR:pec01007]
 Aminotransferase (transaminase)
  Class I
   W5S_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AFI89474
UniProt: A0A0H3I255
Position
complement(1505628..1506842)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSKKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQHYQARDMRDMTVEDVYIGNGVSELIVQSMQALLNPGD
EMLVPAPDYPLWTAAVSLSNGNAVHYLCDESSDWFPDLDDIRKKITANTRGIVIINPNNP
TGAVYSKELLLDIVSIAREHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRNRSWELINQIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKLVLDLLLQEK
VLLVQGTAFNWPYPDHVRIVTLPRIDELDMAIHKLGRFLGHYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgattgaaaaatccaagaaactggagaacgtatgctatgacatccgtggccca
gttctaaaggaagccaagcggcttgaagaagaaggtaataaggtccttaaactgaatatt
ggcaaccctgcgcctttcggctttgaggcaccggacgaaattctggtcgatgtcatccgt
aacctgccaacagcacagggctactgtgattccaaagggctctattccgcccgtaaagcc
atcgttcagcactatcaggcgcgggatatgcgcgatatgacggttgaagacgtctatatt
ggcaacggtgtttccgaactcattgtacaatccatgcaggcgctgctcaatccgggcgat
gaaatgctggttcccgcaccggattaccctctctggaccgcggcggtttccctgtctaac
ggcaatgccgttcactatctctgcgatgagtcctccgattggttccccgatctggatgat
atccgtaaaaagatcactgctaacactcgcggtattgtcatcatcaacccgaacaacccg
acgggtgcggtctacagcaaagaactgttgctggatatcgtgtctatcgcgcgtgaacat
aacctgattattttcgccgacgaaatttacgacaaaattctgtatgacgatgcgcaacac
cactcgattgccgctctggcaccggacctgctgacagtcacgttcaacgggctgtccaag
acataccgtgtggcaggtttccgtcaaggctggatggtactgaacggcccgaaaaaacac
gcaaaaggctatattgaaggactcgaaatgctggcttcaatgcgtttgtgtgccaacgtg
ccgatgcagcatgcgattcagaccgcgttggggggatatcaaagcatcagcgaatttatt
caacccggcgggcgcctgtatgaacagcgtaaccgctcctgggaattgatcaatcaaatc
cccggcgtatcgtgcgtaaaaccacgaggggcgctctatatgttcccacgcattgatgcc
aagcgctttaatatccatgacgaccaaaaactggtactggatctgctgttgcaggaaaag
gtgctactggttcagggcacagcgtttaactggccttacccagaccatgtacgcatcgtc
acgctaccgcgtattgatgagctggacatggcaatccacaaattagggcgtttcctgggg
cattatcatcaataa

DBGET integrated database retrieval system