KEGG   Pectobacterium sp. SCC3193: W5S_1887Help
Entry
W5S_1887          CDS       T02514                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    W5S_1887
Enzymes [BR:pec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     W5S_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046926..2047588
Genome map
AA seq 220 aa AA seqDB search
MSLLSKEAVMVHEALLARGLETPLRGALLDRDTRKQRIAEHMTEIMNLLSLDLSDDSLAE
TPTRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcattattaagtaaagaagccgttatggtgcacgaagcgctgctggcacgcggtctg
gaaacgccgctgcgcggggcgttgttggatcgggatacacgtaagcaacgtattgctgag
catatgacggaaattatgaatttgttgagtctcgatctgagcgatgacagtctggctgaa
acgccgacgcgtatcgccaaaatgtacgttgatgaaatattctccggtttggactacgcc
aactttcccaaaatcaccatcattgaaaacaaaatgaaggtcgatgaaatggtcaccgtg
cgggatatcacgctgaccagcacctgcgaacaccatttcgtgacgatcgatgggaaagcc
acggtcgcgtatattccgaaagatggcgtcattggtttatcgaaacttaaccgcatcgtc
cagtttttctcccagcgcccccaggtgcaggagcgcttaacgcagcagattttggtcgcg
ttgcaaacgctgttgggaacgaacaacgttgccgtctcgattgatgctgtgcactactgc
gtgaaggcacgtggtattcgcgatgcaaccagtgccacgaccacgacatcgctcggcggg
ctgtttaaatccagccagaacacgcgtcaggaattcttgcgcgcggttcgccaccataat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system