KEGG   Pectobacterium sp. SCC3193: W5S_1957Help
Entry
W5S_1957          CDS       T02514                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pec01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pec00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2126339..2127667)
Genome map
AA seq 442 aa AA seqDB search
MADNTKSIGNFSSIVDWQRCSAEEQRQLLTRPAISASDRITAVVSDILTNVKSRGDSALR
DYSAQFDKVQVNAIRVTDAEITAASARLGDEVKQAMAIAVRNIETFHNAQKLPIVDIETQ
PGVRCQQITRPIATVGLYIPGGSAPLPSTVLMLGTPSRIAGCDRVVLCSPPPIADEILYA
AQLCGIKEVFQLGGAQAIAAMAFGTDSVPKVDKIFGPGNAYVTEAKRQVSQQLDGAAIDM
PAGPSEVLVIADSGATPAFVASDLLSQAEHGPDSQVILLTPDAAMAKAVADAVEEQLTHL
SRADIARQALASSRVIVARDLAQCVEISNQYGPEHLIIQTRDAESLVDSITSAGSVFLGD
WSPESAGDYASGTNHVLPTYGYTSTYSSLGLADFQKRMTVQQLTPQGLLQLAPTIETLAQ
AEQLTAHKNAVTLRVAALKEQA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacaccaaaagcatcggcaatttcagctcgatcgttgactggcagcgctgt
tcagcagaagaacaacgtcagttgttgacacgcccggctatttccgcgtcagaccgcatt
accgccgtcgtgagcgatattctgaccaacgtgaaaagccgtggtgatagcgctttacgc
gactacagcgcacagttcgataaggttcaggtgaatgcaattcgcgtcaccgatgctgag
attaccgccgcatctgcccgtctgggtgatgaagtaaaacaggccatggcaatcgccgtg
cgtaatatcgagacattccacaacgcgcaaaaactgccgattgtcgatatcgaaacgcag
ccaggcgtgcgttgccagcagattactcgccctatcgcgaccgttggtctgtatattccc
gggggatcggcgccgctgccgtcaaccgtgctgatgctgggaacgccttcacgcatcgcc
ggctgtgaccgtgtggtgctgtgttcaccaccgccgatcgccgatgaaattctgtatgct
gcacaactgtgcggcattaaagaagtctttcagcttggtggcgcgcaagcgattgctgcc
atggcgtttggcaccgatagtgtgccgaaagtggataaaatttttggccccggcaatgcc
tacgtcacggaagctaagcgccaggtcagccagcagcttgatggtgcagcgattgatatg
cccgcagggccatccgaagtgttggttatcgccgacagcggtgccacaccagcgttcgtc
gcctccgacctattgtcacaggcagagcacggcccggattcacaggtcatcctactcaca
cctgatgccgccatggccaaagccgtcgcagacgccgttgaagagcagctcacacacctg
tctcgtgccgacatcgcacgccaggcgcttgccagcagccgcgtcattgtcgcgcgtgat
ttagcgcagtgtgttgaaatcagcaatcaatatggcccagagcatcttatcattcagacg
cgcgatgcagagtcattagtcgacagcattaccagcgctggttccgtgtttcttggcgac
tggtcgccggaatccgctggtgactatgcctccggcactaaccatgttctgccgacctat
ggctatacctcgacctattcgagcctgggtttggccgattttcagaagcgcatgaccgta
cagcagctcacgccacaggggttactgcaactggcaccaacaatagaaaccctggcacag
gccgaacaactgaccgcccacaaaaacgccgttaccctacgtgttgcagcactgaaggag
caagcatga

DBGET integrated database retrieval system