KEGG   Pectobacterium sp. SCC3193: W5S_1957Help
Entry
W5S_1957          CDS       T02514                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W5S_1957
  Amino acid metabolism
   00340 Histidine metabolism
    W5S_1957
Enzymes [BR:pec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     W5S_1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2126339..2127667)
Genome map
AA seq 442 aa AA seqDB search
MADNTKSIGNFSSIVDWQRCSAEEQRQLLTRPAISASDRITAVVSDILTNVKSRGDSALR
DYSAQFDKVQVNAIRVTDAEITAASARLGDEVKQAMAIAVRNIETFHNAQKLPIVDIETQ
PGVRCQQITRPIATVGLYIPGGSAPLPSTVLMLGTPSRIAGCDRVVLCSPPPIADEILYA
AQLCGIKEVFQLGGAQAIAAMAFGTDSVPKVDKIFGPGNAYVTEAKRQVSQQLDGAAIDM
PAGPSEVLVIADSGATPAFVASDLLSQAEHGPDSQVILLTPDAAMAKAVADAVEEQLTHL
SRADIARQALASSRVIVARDLAQCVEISNQYGPEHLIIQTRDAESLVDSITSAGSVFLGD
WSPESAGDYASGTNHVLPTYGYTSTYSSLGLADFQKRMTVQQLTPQGLLQLAPTIETLAQ
AEQLTAHKNAVTLRVAALKEQA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacaccaaaagcatcggcaatttcagctcgatcgttgactggcagcgctgt
tcagcagaagaacaacgtcagttgttgacacgcccggctatttccgcgtcagaccgcatt
accgccgtcgtgagcgatattctgaccaacgtgaaaagccgtggtgatagcgctttacgc
gactacagcgcacagttcgataaggttcaggtgaatgcaattcgcgtcaccgatgctgag
attaccgccgcatctgcccgtctgggtgatgaagtaaaacaggccatggcaatcgccgtg
cgtaatatcgagacattccacaacgcgcaaaaactgccgattgtcgatatcgaaacgcag
ccaggcgtgcgttgccagcagattactcgccctatcgcgaccgttggtctgtatattccc
gggggatcggcgccgctgccgtcaaccgtgctgatgctgggaacgccttcacgcatcgcc
ggctgtgaccgtgtggtgctgtgttcaccaccgccgatcgccgatgaaattctgtatgct
gcacaactgtgcggcattaaagaagtctttcagcttggtggcgcgcaagcgattgctgcc
atggcgtttggcaccgatagtgtgccgaaagtggataaaatttttggccccggcaatgcc
tacgtcacggaagctaagcgccaggtcagccagcagcttgatggtgcagcgattgatatg
cccgcagggccatccgaagtgttggttatcgccgacagcggtgccacaccagcgttcgtc
gcctccgacctattgtcacaggcagagcacggcccggattcacaggtcatcctactcaca
cctgatgccgccatggccaaagccgtcgcagacgccgttgaagagcagctcacacacctg
tctcgtgccgacatcgcacgccaggcgcttgccagcagccgcgtcattgtcgcgcgtgat
ttagcgcagtgtgttgaaatcagcaatcaatatggcccagagcatcttatcattcagacg
cgcgatgcagagtcattagtcgacagcattaccagcgctggttccgtgtttcttggcgac
tggtcgccggaatccgctggtgactatgcctccggcactaaccatgttctgccgacctat
ggctatacctcgacctattcgagcctgggtttggccgattttcagaagcgcatgaccgta
cagcagctcacgccacaggggttactgcaactggcaccaacaatagaaaccctggcacag
gccgaacaactgaccgcccacaaaaacgccgttaccctacgtgttgcagcactgaaggag
caagcatga

DBGET integrated database retrieval system