KEGG   Pectobacterium sp. SCC3193: W5S_2227Help
Entry
W5S_2227          CDS       T02514                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    W5S_2227
Enzymes [BR:pec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     W5S_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2408033..2408548
Genome map
AA seq 171 aa AA seqDB search
MRTLVFTAEIDNRHGVGIVSSRIGLSSPALLFNPQTSLFGLLEKEHRTQPVDCVLIDECQ
FLTREQVSELSDVVDQLDIPVLCYGLRTDFRGDLFSGSHYLLAWADKLIELKTVCHCGRK
ANCVLRLDAQGNAVHEGEQVVIGGNESYVSVCRKHYKIALGLIRKESELGG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctggtgttcactgcagaaatagataatcggcacggtgtggggatagtaagt
tcacggattggtctttcttctccggcattattgtttaatccgcagacatctttatttgga
ttgctggagaaagagcaccgtactcaacctgtagattgtgtattaattgacgaatgtcaa
tttttaacccgtgagcaggtgagtgagctttccgatgtcgtagaccaattagatatcccg
gtattgtgttacgggttgcgtactgactttcgtggcgatttgttttctggtagtcactat
ttattggcgtgggctgataagttgatcgagttaaaaacggtctgtcattgcggacgtaaa
gctaactgtgtattgcggttagatgcgcagggtaatgctgtccacgaaggggaacaggtc
gttattggcggtaatgaaagttatgtttccgtatgccgtaagcattataagattgctctg
gggttaatccgtaaggaaagcgagttaggtggttaa

DBGET integrated database retrieval system