KEGG   Pectobacterium sp. SCC3193: W5S_2582Help
Entry
W5S_2582          CDS       T02514                                 

Definition
Putative glycosyl hydrolase family5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W5S_2582
Enzymes [BR:pec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     W5S_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2789805..2791322)
Genome map
AA seq 505 aa AA seqDB search
MWLRRKQIVRKLTLGVVTTMLGMSLSFSALSATPVETHGQLSIENGRLVDEQGKRVQLRG
ISSNGLQWVGDYVNKDSMKWLRDDWGINVFRVAMYTAENGYIANPSLANKVKEAVAAAQG
LGVYIIIDWHTLSDNDPNTYKAQAKIFFAEMAGLYGNSPNVIYEIANEPNGSVTWNGQIR
PYALEVTDTIRSKDPDNLIIVGSGTWSQDIHDAADNQLPDPNTLYALHFYAGTHGQFLRD
RIDYAQSRGAAIFVSEWGTSDASGNGGPFLPESQTWIDFLNNRGISWVNWSLSDKSETSA
ALVAGASKSGGWTEQNLSTSGKFVREQIRAGAGLSGGDTPTMPTEPTNPGNGTTGDIVLQ
YRNVDNNPSDDAIRMAFNIKNTGSTPIKLSDLQVRYYFHDDGKPGANLFVDWANVGPNNI
VTSTGTPAASTDKANRYVLVTFASGAGSLQPGAETGEVQVRIHAGDWSNVNETNDYSYGP
NVTSYTNWDKITVHDKGTLVWGTEP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcagaaggaagcaaatcgtcaggaaattgacgctcggtgtagtaacaacgatg
ctgggcatgtcgctcagtttctccgcattatccgccaccccggtggaaacgcatggccag
ttgtccatcgaaaatgggcgattggtggatgaacagggaaagcgggtacaactaagaggg
atcagttcgaatggattgcagtgggttggtgactatgtcaacaaagattcgatgaaatgg
ctgcgtgacgattggggtataaatgtgttccgcgtcgctatgtacacggcggagaatggt
tatattgctaacccttctctcgccaataaagtaaaagaggccgttgcagcggcgcaaggc
ctcggtgtctatatcatcatcgattggcacaccttgtcggataacgatcccaatacttat
aaagcacaggcaaaaatcttctttgccgaaatggcggggctgtatggcaactcgccgaat
gtgatttatgaaatcgccaatgagccaaacggcagtgtgacatggaacgggcagattcga
ccttatgcgctggaagtcactgacaccatccgtagcaaagatcccgataaccttattatc
gtcggcagcgggacctggagccaggatatccatgatgcggcagacaatcagttgcccgat
ccgaatactctgtatgcgctgcatttctatgctggcacgcacgggcagttcctgcgcgat
cgcattgactatgcacaaagccgcggtgctgcaattttcgtcagcgagtggggaaccagc
gatgcgtccggcaatggcgggccgttcctgccagaatcgcagacctggatcgatttcctg
aataaccgtggtataagctgggtgaactggtcgcttagcgataagtctgagacatccgcg
gcgctggtagcgggcgcgagtaaatcaggcggctggacggagcagaatttgtcaacgtca
ggcaaatttgtcagagagcagattcgtgcgggggcgggtctgagcggtggtgatacgccg
acgatgccaacagagccgacgaacccaggtaacggaaccacgggtgacatcgtgctgcaa
tatcgtaatgtggataacaacccttccgatgatgcgattcgtatggcctttaatatcaaa
aatactggaagtacgccgatcaaactcagcgatctgcaagtacgttactacttccatgat
gatggtaagcccggcgcaaacctctttgttgactgggcgaacgtcggccctaacaacatc
gtgaccagtacagggacacctgctgcaagtaccgataaggccaatcgctatgttctggtg
actttcgccagcggcgcgggttcccttcaaccgggcgcggaaacaggtgaagtgcaggtg
cgtatccacgcgggtgactggagcaacgtgaatgagacgaatgactattcatacggccct
aacgtcacgagctacaccaactgggataagatcactgtgcatgataaaggcacgctggtc
tggggcactgagccgtaa

DBGET integrated database retrieval system