KEGG   Pectobacterium sp. SCC3193: W5S_3002Help
Entry
W5S_3002          CDS       T02514                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    W5S_3002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    W5S_3002
Enzymes [BR:pec01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     W5S_3002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3232303..3232839
Genome map
AA seq 178 aa AA seqDB search
MKIIDTAVYGAKIIQPKVFGDARGFFLETFEKKRYQRMLDIDLDFVQDNHSRSSKGVLRG
LHFQKTNPQGKLVRVVRGKVFDVVVDIRQDSSSYGKWCGVTLSEENKTQFWLPPGLAHGF
VVLSELADFEYKCTDYYDPSDEGCLLWNDPEVGIEWPISDPLLSEKDKLGKLFKDVAK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattgatactgctgtttacggcgcaaaaattattcagccgaaagtattcggt
gacgccagaggcttctttcttgaaacgtttgagaagaaacgctatcagaggatgctggat
atcgatttagattttgttcaggataaccattcccgttcgagtaaaggtgtcttacgcggc
ctgcatttccagaaaacaaatccgcagggaaaactggttcgcgtagttcgcggcaaggtt
tttgatgttgtggtggatattcgccaagactcctcttcctacggaaaatggtgtggcgta
acactgtcagaagaaaacaaaacacaattttggctcccaccgggactcgcacatggtttt
gttgtcctctcagagctcgcagatttcgagtacaaatgtacggattattatgatcccagc
gacgaaggctgcctattatggaacgatcctgaggttggtattgaatggccaatatccgat
ccattgctctctgagaaagacaaattagggaagttattcaaggatgtggcaaaatga

DBGET integrated database retrieval system