KEGG   Pectobacterium parmentieri SCC3193: W5S_4294Help
Entry
W5S_4294          CDS       T02514                                 

Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00500  Starch and sucrose metabolism
pec01100  Metabolic pathways
pec01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W5S_4294
Enzymes [BR:pec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     W5S_4294
Exosome [BR:pec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W5S_4294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFI92350
UniProt: A0A0H3IB84
Position
complement(4632342..4634519)
Genome map
AA seq 725 aa AA seqDB search
MSAFSDAINSLISGHYADPFSLLGMHHSSDGLEVRALLPDAQAAWVVDASNGRKIIELER
VDERGFFCGLVPRRKNAFHYQLAVTWREETWVIEDPYRFGPLLQDMDIWLLAEGTHLRPY
ERLGAHLETLDGVEGTRFAVWAPNAQRVSVVGEFNFWDGRRHPMRLRRENGIWELFLPDV
KAGQLYKYEMIDSHGSVRLKADPYAFEAQMRPDTASLITPLPEKVPTNEARREANGLRSP
ISIYEVHLGSWRRHTDNNFWLSYQELANQLIDYVQYMGFTHVELMPINEHPFDGSWGYQP
LGLYAPTRRFGTAPEFRAFVDALHDAGINVLLDWVPGHFPGDEYGLAQFDGTALYEYADP
REGYHQDWNTLIYNYGRHEVRNYLAGNALFWMERYGIDGLRVDAVASMIYRDYSRSEGEW
VPNHYGGKENLEAIAFLRYTNHMLGHAAPAAITLAEESTDYPGVTLPPDCNGLGFHYKWN
MGWMHDTLTYMQLDPVHRKHHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMPGD
VWQKFANLRAYYGFMWAYPGKKLMFMGGEFAQGREWNHDASLDWHLLDEPEGWHRGVQAL
VRDLNHYYRQQPSLYQLDFQPQGFEWLVVDDRENSVFAFVRRDEQGNEVLVVSNFTPVPR
YGYRIGINQPGGWREVMNTDSVHYNGSDQGNVGTIYSEEWGSHQRQHSLVLTIPPLATLY
LVKEA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttttctgatgcgattaattcacttatttccggtcattatgccgatccattt
tcgctgttaggtatgcatcattcctccgacggtcttgaagttcgcgcattgctgccggat
gcgcaggcagcgtgggttgtggatgccagtaacgggcgaaaaatcattgagctggaacgt
gtagatgagcgcggttttttttgtggtctggtgccgcgccggaaaaatgcttttcactat
caattggctgtgacctggcgtgaagaaacctgggtgattgaagatccttaccgatttggc
ccgctattgcaggatatggacatttggctgttggccgaaggtacccacttgcgaccttac
gagcggttaggcgcacatctggaaacgttggatggggtagaaggcacgcgctttgccgtt
tgggcacccaatgcgcagcgcgtttcggtggtgggagaattcaacttttgggatggccgc
cggcacccgatgcggctacgcagggaaaatggcatttgggagctgtttctgcccgatgta
aaagcagggcagctctacaaatatgaaatgatcgacagccacggtagcgtccggctgaag
gccgatccttacgcttttgaagcgcagatgcgcccggataccgcatcactgattacgcca
ctgcctgagaaagtcccgaccaacgaggcccgtcgtgaggcgaatggcctgcgctctcct
atctccatttatgaagtccacctcggttcctggcggcggcatacagataacaatttctgg
ctgagctatcaggagttggcgaaccaactgattgattatgtgcagtacatgggcttcacg
cacgttgagttgatgccgattaacgaacatccgttcgatggcagttggggctatcagccg
ctgggattgtatgcgccaacgcgccgcttcggcactgcgccggaattcagagcgtttgtt
gatgcgctccatgatgcgggtatcaacgtcctgctggactgggtaccggggcatttcccc
ggtgatgaatacggtctggctcagtttgacggcaccgcgctgtatgaatacgccgatccg
cgcgaaggctatcatcaggattggaacacgctgatttacaactatggccgccacgaggtg
cgtaattacctggcaggtaatgcgctgttctggatggagcgctacggtatcgacgggctg
cgggtggatgcagtggcttcgatgatttaccgcgactacagccgcagcgaaggcgagtgg
gtgccgaaccattatggcggtaaagagaacctcgaagccatcgcgttcctgcgttacacc
aaccacatgctgggtcatgcggcacctgcggccatcacacttgctgaagagtccaccgat
tatccgggcgtcacgctgccgccggactgcaacggcttagggtttcactacaagtggaac
atgggctggatgcacgacacgctgacctatatgcagctcgatccggttcaccgtaaacac
catcacgatttgctgacattcggcatgttgtacgcctatagcgagaatttcgtgctgccg
ctgtctcacgacgaagtcgtgcacggcaaacgttcactgttggatcgtatgcccggtgat
gtctggcagaaatttgccaatttacgcgcctattacggttttatgtgggcctatcccggc
aaaaagctgatgtttatgggcggtgaatttgcacaagggcgtgagtggaatcacgacgcc
agtctggattggcacctgctggatgaaccagaagggtggcaccgtggcgtgcaggcgctg
gtgcgcgatcttaaccattactatcgccagcagccgtcgctgtatcaactggattttcag
ccacagggctttgaatggctggtggtggacgatcgggaaaactcggtttttgcctttgtc
cggcgtgatgaacagggcaacgaagtactggtggtcagcaactttacgccagtgccacgc
tacggctatcggattggcattaaccagcccggcggctggcgcgaagtcatgaacaccgat
tctgttcactataacggtagcgatcagggtaacgttgggacgatttacagcgaagagtgg
ggcagccatcagcgccagcactctcttgttctgaccattccgccgcttgccacactgtat
ctggtgaaggaggcgtaa

DBGET integrated database retrieval system