KEGG   Pectobacterium sp. SCC3193: W5S_4330Help
Entry
W5S_4330          CDS       T02514                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    W5S_4330
Enzymes [BR:pec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     W5S_4330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4673105..4673845
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPTGEQLVTRLRKLGYHAWHSPLIEFSPGRELAGLPAQLQALHTDDLVFALS
QHAIHYADPMLTRTGTSWPAHLAYYAIGRTTALALHKISAHPVAYPPERETSETLLQLPE
LQDVAGKRALLLRGNGGRELLGETLTERGAQVTYCECYQRRDVHYDGSEQSRHWQQIGID
KLVITSGEMLQRIYTLVPDYYRASWLLGCQLIVVSERLAEQARQLGWHDIRVADNADNDA
LVRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggttacccgtccgtcacccactggcgaacaactggtgacccgtttaaga
aagctcggctaccacgcctggcacagcccgctgatcgagttttcgcctggacgagaactc
gctggtctgcctgcgcaattacaagccctacacaccgacgacctggtgtttgcgctctca
caacacgcgattcattacgccgatcccatgctgacgcgcacgggcacaagctggcctgcc
cacctcgcttattatgccattggccgcacgacggcactggctttacataaaatcagcgca
caccctgtcgcctatccgcctgaacgtgaaaccagcgaaacgctattgcaacttcctgag
ttacaagatgttgcagggaaacgagcgctattactgcgcggcaacggcggaagggagcta
ctgggtgaaacgttgactgagcggggcgcacaggtaacctactgtgaatgctatcagcgc
cgagatgttcactatgatggctcggaacaaagccgccactggcagcaaataggcatcgac
aaactggtgattaccagcggagaaatgctacaacggatctatactttagtacctgattac
tatcgggcttcctggttacttggctgccagttgatcgtcgttagcgaacgactggcagaa
caagcgcgtcagctcggctggcatgatatccgggtggccgataacgctgataacgatgcg
ctcgtgcgcgcactacaataa

DBGET integrated database retrieval system