KEGG   Pectobacterium sp. SCC3193: W5S_4711Help
Entry
W5S_4711          CDS       T02514                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    W5S_4711
Enzymes [BR:pec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     W5S_4711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5066327..5067253)
Genome map
AA seq 308 aa AA seqDB search
MKTGKLVVLGSINADHILNLEQFPRPGETVIGEQYSVAFGGKGANQAVAAGRSGADIAFI
ASVGNDDIGARICQQLSKDNIDVSAVEAISGETTGVALIFVNADAENMIAINAGANAAVT
PDYLHRHQQHIIDASALLMQLESPLETVIAAAKLAHEHQTKVILNPAPARELPDELLSLV
DMITPNETEAQFLTGITVETEEDAARAAQILHDKGIETVLITLGSRGVWLSERGQGQRIP
GYRVKAVDTIAAGDTFNGALVTALLENRPMSSAVKFAHAAAAIAVTRRGAQPSVPWREEI
DAFLQAQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgggtaagctggtggtgctgggcagtattaatgctgaccatattctcaatctt
gagcaatttccccgcccgggcgaaacggtgatcggtgaacaatatagtgtcgctttcggc
ggaaaaggggctaaccaagcggttgccgctggccgaagcggtgcggatattgcttttatt
gccagcgttggaaacgatgatattggtgctcgcatttgtcagcagctatccaaggataac
attgatgtttccgccgttgaggctatctctggggaaacaacgggcgttgcgctgattttt
gttaacgctgacgctgagaacatgattgccattaacgctggcgcgaatgctgctgtgaca
ccagattatcttcaccgtcatcagcaacacattattgatgcttctgcgttgctgatgcag
cttgagtcgccgttggaaacggttatcgccgcagccaaattggcacatgaacaccaaaca
aaggtgattcttaaccctgcccctgctcgtgaactgcctgatgaactgttatcactggtc
gatatgatcacgccgaatgaaaccgaagcgcagttcttgacgggaattaccgttgagacg
gaagaggatgccgctcgcgcagcacagattctgcatgataaaggtatcgagacggtgctc
atcacattgggtagccgtggcgtatggttgagtgaacgtggtcaagggcagcgtattccg
gggtatcgtgtaaaagccgtggatactattgctgccggagacacctttaatggtgcgttg
gttaccgcgttgttggaaaatcggccaatgtcttcagcggtgaagttcgctcatgcggcg
gcagcgattgcggtaactcgccgaggcgctcaaccctctgtcccatggcgcgaagagatc
gacgcatttttgcaagctcaggagtga

DBGET integrated database retrieval system