KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00011Help
Entry
SAR11G3_00011     CDS       T01465                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pel00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10724..11845)
Genome map
AA seq 373 aa AA seqDB search
MKYKTIKLSLLLILLSFSTLKADTTKKAFLDVGINSIREWSSCKTGPIPEAKIEEYEQVI
NDGWRHINIILCGHKDFPNDKFKKTGFDIRIKNLRTQIEILLKKYPNIAFGISFKGYKPV
GGTGKYGWDVKGRPQAILYKRIEDSPELQKEYLKWWRFVANEFKDMDRVVFTIMNEPEWH
KISKGKKKWRKLSLEAIDAIREISPNRWIILEGINKSLIARDWTARGVMGKPVDRDKIIY
GFHYYLTNNAGPESENNPKIVVKKINKSEYSNGWKALKSVIKYGERYKVPVSVTEFGMTG
FLKGTGGVDLNLRTDFVKNTIVKYMDACNECGLTWWALGDYNTPYLRQSSKKYQNYPRVP
DKNLFEVLKLKKP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaactataaagttaagtttgttattaattcttttatcattctcaacttta
aaagcagacacaactaaaaaagcctttttagatgttgggattaattcaatcagagaatgg
tcaagttgtaaaactggtccaattccagaagctaagattgaagagtatgagcaagtaatt
aatgatggttggcgacatataaacattatcctttgcggacataaggattttccaaatgat
aagtttaaaaaaacaggttttgatattagaattaagaaccttagaacacaaattgaaata
ttattaaaaaagtatcctaatatcgcttttggaataagttttaaaggatataaacctgtt
ggtggaactggaaaatatggatgggatgtaaaaggtagaccacaagcaatattatataaa
cgtatagaagactcaccagagttacaaaaagaatatttaaaatggtggcgttttgttgcc
aatgaatttaaagatatggatcgggttgtcttcactataatgaatgagcctgaatggcac
aagatatctaaaggtaaaaaaaaatggcgtaaattatcactagaagctattgatgctatc
cgagaaatttctccaaatcgttggattattctagaaggtataaataaatcactaattgcc
agagattggactgcgagaggtgttatgggtaaaccagtggatagagataaaattatttat
ggtttccattattatttaacaaataatgcagggccagagtctgaaaacaatccaaaaatt
gttgtgaaaaaaattaataaaagtgaatattcaaatggatggaaggcattaaaaagcgtt
attaaatatggtgaacgatataaagttccagtaagcgttacagaatttggaatgactgga
tttctaaaaggtacaggtggcgtggatttaaatttgcgaacagattttgtcaaaaatact
attgtaaaatatatggatgcttgtaatgagtgtggacttacatggtgggcgttgggggat
tataatacaccatatttgagacaaagctcaaaaaagtatcaaaattatcctcgtgtaccc
gataaaaatttatttgaagttctgaagttaaagaaaccctga

DBGET integrated database retrieval system