KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00011Help
Entry
SAR11G3_00011     CDS       T01465                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAR11G3_00011
Enzymes [BR:pel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SAR11G3_00011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10724..11845)
Genome map
AA seq 373 aa AA seqDB search
MKYKTIKLSLLLILLSFSTLKADTTKKAFLDVGINSIREWSSCKTGPIPEAKIEEYEQVI
NDGWRHINIILCGHKDFPNDKFKKTGFDIRIKNLRTQIEILLKKYPNIAFGISFKGYKPV
GGTGKYGWDVKGRPQAILYKRIEDSPELQKEYLKWWRFVANEFKDMDRVVFTIMNEPEWH
KISKGKKKWRKLSLEAIDAIREISPNRWIILEGINKSLIARDWTARGVMGKPVDRDKIIY
GFHYYLTNNAGPESENNPKIVVKKINKSEYSNGWKALKSVIKYGERYKVPVSVTEFGMTG
FLKGTGGVDLNLRTDFVKNTIVKYMDACNECGLTWWALGDYNTPYLRQSSKKYQNYPRVP
DKNLFEVLKLKKP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaactataaagttaagtttgttattaattcttttatcattctcaacttta
aaagcagacacaactaaaaaagcctttttagatgttgggattaattcaatcagagaatgg
tcaagttgtaaaactggtccaattccagaagctaagattgaagagtatgagcaagtaatt
aatgatggttggcgacatataaacattatcctttgcggacataaggattttccaaatgat
aagtttaaaaaaacaggttttgatattagaattaagaaccttagaacacaaattgaaata
ttattaaaaaagtatcctaatatcgcttttggaataagttttaaaggatataaacctgtt
ggtggaactggaaaatatggatgggatgtaaaaggtagaccacaagcaatattatataaa
cgtatagaagactcaccagagttacaaaaagaatatttaaaatggtggcgttttgttgcc
aatgaatttaaagatatggatcgggttgtcttcactataatgaatgagcctgaatggcac
aagatatctaaaggtaaaaaaaaatggcgtaaattatcactagaagctattgatgctatc
cgagaaatttctccaaatcgttggattattctagaaggtataaataaatcactaattgcc
agagattggactgcgagaggtgttatgggtaaaccagtggatagagataaaattatttat
ggtttccattattatttaacaaataatgcagggccagagtctgaaaacaatccaaaaatt
gttgtgaaaaaaattaataaaagtgaatattcaaatggatggaaggcattaaaaagcgtt
attaaatatggtgaacgatataaagttccagtaagcgttacagaatttggaatgactgga
tttctaaaaggtacaggtggcgtggatttaaatttgcgaacagattttgtcaaaaatact
attgtaaaatatatggatgcttgtaatgagtgtggacttacatggtgggcgttgggggat
tataatacaccatatttgagacaaagctcaaaaaagtatcaaaattatcctcgtgtaccc
gataaaaatttatttgaagttctgaagttaaagaaaccctga

DBGET integrated database retrieval system