KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00076Help
Entry
SAR11G3_00076     CDS       T01465                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAR11G3_00076
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR11G3_00076
Enzymes [BR:pel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SAR11G3_00076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59908..60297)
Genome map
AA seq 129 aa AA seqDB search
MINRVKIYKLKEIKSSAGSIVKYIDNKKPFFKGFGEVYFNEIKKGYTKGWNLHKECKSLI
YVSHGTVKFTIMNRSKKEKKVFKISRSNPSILCIPPKLWFKFESMTNFSIIVNFINQVHS
KNEVEKHPL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgattaatagggttaaaatttataaacttaaagaaataaaaagctctgcagggagtatt
gtaaaatatatagataataaaaaacctttttttaagggatttggtgaggtgtactttaac
gaaattaaaaaaggatatacaaaaggttggaatttacacaaagagtgcaaatcacttatt
tacgtatcacatggtacagttaaatttacaataatgaacagaagtaaaaaggaaaaaaaa
gtatttaaaatttcaaggtctaatccttcaattttatgtatacctccaaaactttggttt
aaatttgaatctatgacaaatttttcaattattgttaactttatcaatcaagtgcatagt
aaaaatgaagttgaaaagcatccactctaa

DBGET integrated database retrieval system