KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00076Help
Entry
SAR11G3_00076     CDS       T01465                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pel00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59908..60297)
Genome map
AA seq 129 aa AA seqDB search
MINRVKIYKLKEIKSSAGSIVKYIDNKKPFFKGFGEVYFNEIKKGYTKGWNLHKECKSLI
YVSHGTVKFTIMNRSKKEKKVFKISRSNPSILCIPPKLWFKFESMTNFSIIVNFINQVHS
KNEVEKHPL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgattaatagggttaaaatttataaacttaaagaaataaaaagctctgcagggagtatt
gtaaaatatatagataataaaaaacctttttttaagggatttggtgaggtgtactttaac
gaaattaaaaaaggatatacaaaaggttggaatttacacaaagagtgcaaatcacttatt
tacgtatcacatggtacagttaaatttacaataatgaacagaagtaaaaaggaaaaaaaa
gtatttaaaatttcaaggtctaatccttcaattttatgtatacctccaaaactttggttt
aaatttgaatctatgacaaatttttcaattattgttaactttatcaatcaagtgcatagt
aaaaatgaagttgaaaagcatccactctaa

DBGET integrated database retrieval system