KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00152Help
Entry
SAR11G3_00152     CDS       T01465                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pel01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pel00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pel00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124792..126954
Genome map
AA seq 720 aa AA seqDB search
MSSNFINVEKTKINEDLYNFVNNEIIPGTSIDKDIFWKGFVSSSNELAKKNKSLLKKRAD
LQKSVDTWHVDNKDNFSLKSYKIFLKEIGYLVDEQEDFKIETANVDDEISKIAGPQLVVP
IDNARYALNAANARWGSLYDALYGTDAISDENGCEKLKSYNPKRGKKVIDSGRDFLNQIA
PLDKGNWKDVSGFLIENGNLAIHLSDQSKTQLKNKEKFIGYVGEKNKPSSILLKNNYLHV
ELQIDSQHIIGKDDPSHISDIVIESAISTIMDLEDSVAAVDAEDKINCYRNWLGIAKGTL
QAEMEKNGKKIIRKLNSDRKYLDTNDNPISLHGRSLILLRNVGHLMTNPSILLDDGSEIP
EGILDAFITTLCALHDMKNKLNSRAGSVYIVKPKMHGPEEVAFADEIFTHVEKVLNLKPN
TVKIGIMDEERRTTVNLKECIRQAKKRIAFINTGFLDRTGDEMHTSFQAGPMIFKSEMKK
SKWLLAYENWNVDIGLSCGFSGKAQIGKGMWAMPDRMKDMLDQKAGHPIAGANCAWVPSP
TAATLHATHYHKINVFERQQELSSRDRANIDDILNIPMADRPNWSKEEINKEIENNAQGI
LGYVVRWIDQGVGCSKVPDINNIGLMEDRATLRISSQHIANWLHHQICTKDKVMEIMKKM
AKVVDEQNNSDKHYVPMAPNFDHSIAFKAACDLVFKGMEQPSGYTEPVLHQRRLEKKLAN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaactttattaacgtagaaaaaaccaaaattaacgaggacctatataatttt
gttaataatgaaattattccaggcacttcgatagacaaagatattttttggaaaggcttt
gtttcctcttcaaatgaattggctaaaaaaaataagtctctcttaaaaaaaagagctgat
cttcaaaagagtgtggacacttggcatgttgataataaagataattttagccttaagtcg
tacaaaatttttttaaaagaaattggctaccttgttgatgagcaggaagactttaaaata
gaaactgcaaatgttgatgatgaaatttctaagattgcaggtcctcaacttgttgtgcct
attgacaatgcgaggtatgcattaaacgcagcaaatgcaagatggggtagtctttacgat
gcgctgtatggaacagatgcaatctccgatgagaatggttgtgaaaaattaaaatcatac
aatccaaaaagagggaaaaaagtcatagacagtggaagagattttttaaatcaaattgct
cccttagataaaggtaactggaaagatgtttcaggatttttaatagaaaatggaaactta
gctattcatctgtctgatcaatctaaaacgcaattaaaaaataaagaaaaattcataggt
tatgtgggagaaaaaaataaacctagttcaattctattaaagaataattatttacatgtt
gagctgcaaatagattcccaacacattattgggaaagacgatccatctcatattagtgac
attgttattgaatcagcaatatcaactattatggatttagaagattctgtggctgcagta
gacgctgaagataaaattaattgctacagaaattggcttggaatcgcaaaaggaactctt
caagctgaaatggaaaagaacggaaaaaaaattataagaaaactaaattcggatagaaaa
tatttagatacaaatgacaatccaattagccttcacggcagatctttaattttgttgaga
aatgtaggtcatctaatgaccaatccatcgattttattagatgatggatctgaaattcca
gaaggaatattggatgctttcataactacactttgtgcacttcatgatatgaaaaataag
cttaattcaagagctggctctgtctatatagttaaaccaaaaatgcatggtccagaggaa
gttgcttttgcagatgaaatttttactcacgtggaaaaagttttaaacttaaaacccaat
acggtaaaaataggaattatggatgaggaaagaagaactactgtgaatttgaaagaatgt
attaggcaggcaaaaaaaagaattgcttttattaatactggttttttagacagaactgga
gatgaaatgcatacctcttttcaggcaggaccaatgatttttaaaagtgaaatgaaaaaa
tctaaatggctgttagcttacgaaaattggaatgtggatataggattaagctgtggattt
tcaggaaaagctcagattggtaaaggaatgtgggcaatgcccgatagaatgaaagacatg
ttggaccaaaaagcaggtcatcctattgcaggagctaattgtgcatgggtcccttcccct
actgctgctacgttacatgccacccactatcataaaataaatgtttttgagagacagcaa
gaattatcgtcaagagacagggcaaacatagatgatattttaaatattcctatggcagac
aggccgaactggtctaaggaagagattaataaggaaattgaaaataatgctcaaggtatt
cttggctatgtagttagatggattgatcaaggtgtgggatgttctaaagttccagatatt
aataatatcggtttaatggaagacagagctactttgagaatttcctctcaacacattgct
aactggttgcatcaccaaatttgcacaaaggataaagtaatggaaataatgaaaaaaatg
gcaaaagtggttgatgagcaaaacaattctgacaaacactatgttcccatggcacctaat
tttgatcattctatagcgtttaaggcagcttgtgatttggtgtttaaaggaatggaacag
ccttcaggatatacagagccggtcttgcatcaaagaagactagaaaaaaaattagctaac
taa

DBGET integrated database retrieval system