KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00302Help
Entry
SAR11G3_00302     CDS       T01465                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_00302
   01230 Biosynthesis of amino acids
    SAR11G3_00302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_00302
  Energy metabolism
   00680 Methane metabolism
    SAR11G3_00302
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11G3_00302
Enzymes [BR:pel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAR11G3_00302
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAR11G3_00302
  Exosomal proteins of melanoma cells
   SAR11G3_00302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274353..275072
Genome map
AA seq 239 aa AA seqDB search
MANLILVRHGQSQWNLENRFTGWYDAQLTGQGKEEAKKSGQLIHQLNINFEQAFTSFQKR
AFNTLSIILEEIDQKNLITTKAWQLNERHYGGLQGLNKAETAKKYGEEQVMTWRRSYKTP
PPDLDPSDPNHPIHNKIYKDIDPKLIPNSESLLDTYNRAVPFYIKEIESMLKKEKNILVS
AHGNSLRAICKKIFNISDAMITKLEIPTGNPILIEMDNLKVNAFKYLDEARSKEIITDQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttaatattagtgagacacggccaaagtcagtggaacttagaaaataggttc
acaggatggtacgatgcccaactaacagggcaaggaaaggaagaggctaaaaaatctggt
caactcattcatcagttaaatattaactttgagcaagctttcacttcctttcaaaaaaga
gcatttaataccctgtcaattattttagaagaaattgatcaaaaaaatttaattaccaca
aaggcttggcaactgaatgaaaggcattacggtggattgcagggactaaataaagccgaa
actgccaagaagtatggggaagagcaggtcatgacttggagaagaagttacaaaacaccc
cctccggatctagacccaagtgatcctaaccaccctattcataataaaatttacaaagat
attgatccaaaattaattcctaattcagaatctttgctagatacgtataaccgtgcagtc
cctttttatattaaagaaatagaatctatgctgaagaaagaaaaaaatattttagtctcc
gctcatggaaatagcttaagagctatttgtaaaaaaatttttaatatttctgatgcaatg
attacaaagttagaaattccaactggaaatccaattcttattgaaatggataacttgaaa
gtaaatgcttttaaatatcttgatgaagctcgatctaaagaaattattactgatcaatag

DBGET integrated database retrieval system