KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00302Help
Entry
SAR11G3_00302     CDS       T01465                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_00302
   01230 Biosynthesis of amino acids
    SAR11G3_00302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_00302
  Energy metabolism
   00680 Methane metabolism
    SAR11G3_00302
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11G3_00302
Enzymes [BR:pel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAR11G3_00302
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAR11G3_00302
  Exosomal proteins of melanoma cells
   SAR11G3_00302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274353..275072
Genome map
AA seq 239 aa AA seqDB search
MANLILVRHGQSQWNLENRFTGWYDAQLTGQGKEEAKKSGQLIHQLNINFEQAFTSFQKR
AFNTLSIILEEIDQKNLITTKAWQLNERHYGGLQGLNKAETAKKYGEEQVMTWRRSYKTP
PPDLDPSDPNHPIHNKIYKDIDPKLIPNSESLLDTYNRAVPFYIKEIESMLKKEKNILVS
AHGNSLRAICKKIFNISDAMITKLEIPTGNPILIEMDNLKVNAFKYLDEARSKEIITDQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttaatattagtgagacacggccaaagtcagtggaacttagaaaataggttc
acaggatggtacgatgcccaactaacagggcaaggaaaggaagaggctaaaaaatctggt
caactcattcatcagttaaatattaactttgagcaagctttcacttcctttcaaaaaaga
gcatttaataccctgtcaattattttagaagaaattgatcaaaaaaatttaattaccaca
aaggcttggcaactgaatgaaaggcattacggtggattgcagggactaaataaagccgaa
actgccaagaagtatggggaagagcaggtcatgacttggagaagaagttacaaaacaccc
cctccggatctagacccaagtgatcctaaccaccctattcataataaaatttacaaagat
attgatccaaaattaattcctaattcagaatctttgctagatacgtataaccgtgcagtc
cctttttatattaaagaaatagaatctatgctgaagaaagaaaaaaatattttagtctcc
gctcatggaaatagcttaagagctatttgtaaaaaaatttttaatatttctgatgcaatg
attacaaagttagaaattccaactggaaatccaattcttattgaaatggataacttgaaa
gtaaatgcttttaaatatcttgatgaagctcgatctaaagaaattattactgatcaatag

DBGET integrated database retrieval system