KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00317Help
Entry
SAR11G3_00317     CDS       T01465                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAR11G3_00317
Enzymes [BR:pel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SAR11G3_00317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288573..288989
Genome map
AA seq 138 aa AA seqDB search
MRRCLDYKNIEIVSFGIRNLCSDEYKYYKSIPKRMKIFWGKDMENWNLSILKKMIKNKNV
YITFDLDGFDSSLMSATGTPEPGGLFWNDAMRILKITSENSNIVGADINELAPKKNLHAC
DFIAAKLAYKILSYKFRK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatgcttagattacaagaatatagaaattgtttcttttggaataagaaattta
tgtagcgatgaatacaaatattacaaatctatacccaaaagaatgaaaatcttttgggga
aaagatatggaaaactggaatcttagtattcttaagaaaatgattaaaaataaaaatgtc
tacattactttcgacctagatggatttgactcaagcttaatgtcggcaactggtactcct
gaaccgggaggtttattttggaatgatgctatgagaatattgaaaattacttctgaaaat
tcaaatatagtaggtgcggatataaatgagctagcccctaagaaaaacctacatgcatgt
gactttattgcggcaaaattagcttataaaatactatcttacaaatttagaaaatag

DBGET integrated database retrieval system