KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00377Help
Entry
SAR11G3_00377     CDS       T01465                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pel01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pel00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pel00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pel00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pel00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
343843..345786
Genome map
AA seq 647 aa AA seqDB search
MSNTDKVFKVNDEWSKIAHANKEIYETKYKKSLEDNDAFWAEEGKRIDWIKPYSKIKDVI
YSKAKTEIKWFYDGTLNASYNCIDRHLKNKANQTAIIFEGDDPTVSNKITYQELSDEVCK
LANGFKKIGIKKGDRVTLYMPMVPAAVYSMLACARIGAIHSVVFGGFSPESLAGRIVDCK
SEYVITADEGVRGQKSIPLKKNTDEALKKCPNVKKNIVLKHTGGSIDWNDKIDVWYHDLI
KDESTTCKPEEMNAEDPLFILYTSGSTGKPKGVMHTTGGYMVYASMTHEYIFDYKEGDVY
WCTADVGWVTGHSYIVYGPLANGATTLVFEGVPNYPDAGRFWQVCDKHQVNIFYTAPTAL
RALMREGDSFVKKHNRKSLKLLGSVGEPINPEAWLWYHKVVGDSRCPIVDTWWQTETGGI
LISPQPGAIDLKPGSATKPFYGIKPIIVDEKGNELEGACSGNLCIGQSWPGQMRTVYGDH
QRFIETYFAAYEGKYFTGDGCRRDEDGYYWITGRVDDVVIVSGHNLGTAEIESAFVSHPK
VAEAAIVGYPHDIKGQGLYCYVTLNAGLEGSEELIKDLKQWVRKEIGPLATPDLIHFTPG
LPKTRSGKIMRRILRKVAENDYGNLGDTSTLADPTVVQSLIDNRLNK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatacagataaggtttttaaagttaatgatgagtggtcgaaaattgctcacgct
aataaagaaatttacgaaacaaaatataaaaaatctttagaagataatgatgctttctgg
gcagaagaaggaaagagaattgattggattaagccctattctaaaatcaaagatgtgatt
tatagtaaggccaaaactgaaataaagtggttttatgatggaacgttaaatgcttcatac
aactgcattgacagacatctaaaaaacaaagccaatcaaactgccattatttttgaagga
gatgatcctaccgtctctaataaaatcacctatcaagaattaagtgatgaagtttgtaaa
ttagccaatggctttaaaaaaattggaattaaaaaaggagaccgagttactctatacatg
cccatggttccagctgccgtatattctatgttagcatgtgcaagaattggtgcaattcat
tctgtagtatttggaggattttctccagaatctttagctggaagaattgttgattgtaaa
tctgaatatgtcattacggcagatgagggtgttcggggacagaagtctattcctctaaaa
aaaaatacagatgaagcattaaaaaaatgtcccaatgttaagaaaaatattgttttaaaa
catacgggtggttctattgattggaatgataaaattgatgtttggtatcatgatttaatt
aaagatgaatctactacctgcaaacctgaagaaatgaatgcagaagatcctctatttatt
ctttacacgtctggttctacaggaaaaccaaaaggcgttatgcatacgacgggtggttac
atggtgtacgcatccatgacccatgaatatatttttgattacaaagaaggtgatgtttac
tggtgtacggcggatgtaggttgggtaacaggccatagttacattgtgtacggtcctctt
gcaaatggagctactactttagtgtttgagggagttccaaactatccagacgctggaagg
ttttggcaagtatgtgacaagcaccaagtaaatattttttatactgctcctacagcttta
cgagctctcatgagagaaggagatagttttgtcaaaaaacacaatcgaaaatctttaaaa
cttttaggatctgttggtgaaccaatcaatcctgaggcttggctttggtatcataaagtg
gttggtgactctcgatgtcctattgtagatacgtggtggcagactgaaacgggtggaata
ttgatttccccccaaccaggtgcaatcgatttaaaaccaggatcagcaacaaaaccgttc
tatggcattaaaccaattattgtcgatgaaaaaggaaatgagctagaaggtgcttgctcc
ggaaatttatgcattggtcaatcgtggcctggacagatgagaactgtatatggagaccac
cagagatttattgaaacatattttgcagcctacgaaggaaaatattttacaggtgatggc
tgtagacgagatgaggatggctactattggattactggacgagtagacgatgtcgttatt
gtttcaggtcacaatttaggaactgctgaaattgaaagtgcctttgtatcacatccaaaa
gtagctgaagcagcaattgtgggttaccctcatgatattaagggacagggtctatattgt
tatgtcactcttaatgcgggcctagaagggtcggaagaacttatcaaggatttaaaacaa
tgggttcgaaaagaaatcggtccccttgcaacgcctgatctaattcactttactccaggt
ttgcccaaaaccaggtcggggaaaattatgagaagaattctaagaaaggttgctgaaaat
gactatggtaatcttggagatacctcgactctagcagatccaacagtggtacagagttta
atagacaataggttaaataaataa

DBGET integrated database retrieval system