KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00377Help
Entry
SAR11G3_00377     CDS       T01465                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00010  Glycolysis / Gluconeogenesis
pel00620  Pyruvate metabolism
pel00640  Propanoate metabolism
pel00680  Methane metabolism
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01130  Biosynthesis of antibiotics
pel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_00377
   00620 Pyruvate metabolism
    SAR11G3_00377
   00640 Propanoate metabolism
    SAR11G3_00377
  Energy metabolism
   00680 Methane metabolism
    SAR11G3_00377
Enzymes [BR:pel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAR11G3_00377
Lipid biosynthesis proteins [BR:pel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAR11G3_00377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA80852
UniProt: F2I2U7
Position
343843..345786
Genome map
AA seq 647 aa AA seqDB search
MSNTDKVFKVNDEWSKIAHANKEIYETKYKKSLEDNDAFWAEEGKRIDWIKPYSKIKDVI
YSKAKTEIKWFYDGTLNASYNCIDRHLKNKANQTAIIFEGDDPTVSNKITYQELSDEVCK
LANGFKKIGIKKGDRVTLYMPMVPAAVYSMLACARIGAIHSVVFGGFSPESLAGRIVDCK
SEYVITADEGVRGQKSIPLKKNTDEALKKCPNVKKNIVLKHTGGSIDWNDKIDVWYHDLI
KDESTTCKPEEMNAEDPLFILYTSGSTGKPKGVMHTTGGYMVYASMTHEYIFDYKEGDVY
WCTADVGWVTGHSYIVYGPLANGATTLVFEGVPNYPDAGRFWQVCDKHQVNIFYTAPTAL
RALMREGDSFVKKHNRKSLKLLGSVGEPINPEAWLWYHKVVGDSRCPIVDTWWQTETGGI
LISPQPGAIDLKPGSATKPFYGIKPIIVDEKGNELEGACSGNLCIGQSWPGQMRTVYGDH
QRFIETYFAAYEGKYFTGDGCRRDEDGYYWITGRVDDVVIVSGHNLGTAEIESAFVSHPK
VAEAAIVGYPHDIKGQGLYCYVTLNAGLEGSEELIKDLKQWVRKEIGPLATPDLIHFTPG
LPKTRSGKIMRRILRKVAENDYGNLGDTSTLADPTVVQSLIDNRLNK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatacagataaggtttttaaagttaatgatgagtggtcgaaaattgctcacgct
aataaagaaatttacgaaacaaaatataaaaaatctttagaagataatgatgctttctgg
gcagaagaaggaaagagaattgattggattaagccctattctaaaatcaaagatgtgatt
tatagtaaggccaaaactgaaataaagtggttttatgatggaacgttaaatgcttcatac
aactgcattgacagacatctaaaaaacaaagccaatcaaactgccattatttttgaagga
gatgatcctaccgtctctaataaaatcacctatcaagaattaagtgatgaagtttgtaaa
ttagccaatggctttaaaaaaattggaattaaaaaaggagaccgagttactctatacatg
cccatggttccagctgccgtatattctatgttagcatgtgcaagaattggtgcaattcat
tctgtagtatttggaggattttctccagaatctttagctggaagaattgttgattgtaaa
tctgaatatgtcattacggcagatgagggtgttcggggacagaagtctattcctctaaaa
aaaaatacagatgaagcattaaaaaaatgtcccaatgttaagaaaaatattgttttaaaa
catacgggtggttctattgattggaatgataaaattgatgtttggtatcatgatttaatt
aaagatgaatctactacctgcaaacctgaagaaatgaatgcagaagatcctctatttatt
ctttacacgtctggttctacaggaaaaccaaaaggcgttatgcatacgacgggtggttac
atggtgtacgcatccatgacccatgaatatatttttgattacaaagaaggtgatgtttac
tggtgtacggcggatgtaggttgggtaacaggccatagttacattgtgtacggtcctctt
gcaaatggagctactactttagtgtttgagggagttccaaactatccagacgctggaagg
ttttggcaagtatgtgacaagcaccaagtaaatattttttatactgctcctacagcttta
cgagctctcatgagagaaggagatagttttgtcaaaaaacacaatcgaaaatctttaaaa
cttttaggatctgttggtgaaccaatcaatcctgaggcttggctttggtatcataaagtg
gttggtgactctcgatgtcctattgtagatacgtggtggcagactgaaacgggtggaata
ttgatttccccccaaccaggtgcaatcgatttaaaaccaggatcagcaacaaaaccgttc
tatggcattaaaccaattattgtcgatgaaaaaggaaatgagctagaaggtgcttgctcc
ggaaatttatgcattggtcaatcgtggcctggacagatgagaactgtatatggagaccac
cagagatttattgaaacatattttgcagcctacgaaggaaaatattttacaggtgatggc
tgtagacgagatgaggatggctactattggattactggacgagtagacgatgtcgttatt
gtttcaggtcacaatttaggaactgctgaaattgaaagtgcctttgtatcacatccaaaa
gtagctgaagcagcaattgtgggttaccctcatgatattaagggacagggtctatattgt
tatgtcactcttaatgcgggcctagaagggtcggaagaacttatcaaggatttaaaacaa
tgggttcgaaaagaaatcggtccccttgcaacgcctgatctaattcactttactccaggt
ttgcccaaaaccaggtcggggaaaattatgagaagaattctaagaaaggttgctgaaaat
gactatggtaatcttggagatacctcgactctagcagatccaacagtggtacagagttta
atagacaataggttaaataaataa

DBGET integrated database retrieval system