KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00473Help
Entry
SAR11G3_00473     CDS       T01465                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_00473
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00473
   00650 Butanoate metabolism
    SAR11G3_00473
  Energy metabolism
   00190 Oxidative phosphorylation
    SAR11G3_00473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423445..423780
Genome map
AA seq 111 aa AA seqDB search
MRNIAVTKWILQRVTAVILLPLLIWFLSVFIGLVQKDFTTVIIFFENNINFSFSVVFLVL
VFSHMKIGMGEIFEDYIQDSRYKSVANLIISIFATVLPLITIVSLILIKFN
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattgcagttaccaagtggattttacaaagagttacagcagttatccttttg
cctttgcttatttggtttttatcagtctttatcggtttagttcaaaaagatttcacaacg
gttataattttttttgaaaacaatattaatttttctttttcagtagtttttttagtttta
gtgttttctcatatgaagattggaatgggagaaatatttgaagattatatacaagatagc
cgatacaaaagtgtcgcaaatttaataatttctatcttcgctactgttcttcctttaata
actattgtatctttaatcttaattaaatttaattaa

DBGET integrated database retrieval system