KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00478Help
Entry
SAR11G3_00478     CDS       T01465                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00020  Citrate cycle (TCA cycle)
pel00640  Propanoate metabolism
pel00660  C5-Branched dibasic acid metabolism
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01130  Biosynthesis of antibiotics
pel01200  Carbon metabolism
Module
pel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00478
   00640 Propanoate metabolism
    SAR11G3_00478
   00660 C5-Branched dibasic acid metabolism
    SAR11G3_00478
Enzymes [BR:pel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAR11G3_00478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEA80953
UniProt: F2I3I5
Position
428977..430137
Genome map
AA seq 386 aa AA seqDB search
MNIHEHQAKDILKKFGAEVPNGEPIFSLDEIDEKFKKIKTDKVVLKAQIHAGGRGKAGGV
KIVDNLEQLKEEAKNLLGKVLVTHQTGPQGREVKRLYIEEASDISKEFYLSCLVDRASSK
IAFISSAEGGMDIEEVANKTPEKITTTRVSLSKGLTKEDITQVLKPYQLPSESIEQAEKL
IQSIFKALLNTDANLIEVNPLILTKENQVLCLDAKINFDANALYRHPDILELRDFDEEDP
AEIEASKYDLAYIKLDGEIGCMVNGAGLAMATMDIIKLYGSEPANFLDVGGGATKEKVSA
AFNIILSDKNVKGILINIFGGIMRCDVIAEGVIAAAKETNLSVPLVVRLAGTKFEEGKKI
LEQSGLKIIPANDLSEAAQKIVEAIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagcatcaagccaaggacattctaaaaaaatttggagcagaagttccc
aatggagagcccattttttcactagacgaaatagatgaaaagtttaaaaaaataaaaaca
gataaagttgtccttaaagcccaaatccatgctggaggaagaggtaaagcaggtggggtt
aaaattgttgataatcttgaacaattaaaggaagaggctaaaaatttactagggaaagtt
cttgtcactcatcaaacagggccccagggtagggaagtaaaaagactgtatattgaagag
gcttcagatatttcaaaagaattctacctatcttgtcttgtagatcgtgcaagttctaaa
attgcttttatttcaagcgctgagggaggaatggatatagaagaagttgctaacaaaact
ccagaaaaaattaccactactcgtgttagtctttctaaaggattaacaaaagaagacata
acacaagtattaaagccatatcagcttccttcagaatctatcgagcaagctgaaaaactt
attcaatctatttttaaggctttgctaaatacagacgcaaacttaattgaagtaaatcct
ttaattctaacaaaagaaaatcaagtattgtgtcttgatgcaaaaattaattttgatgca
aatgcattatatcgtcatccagacattttggaattaagagattttgatgaagaagatcct
gcagaaatagaagcaagtaaatatgatttggcctacatcaaattagatggagaaattggt
tgtatggtaaatggcgcaggacttgccatggctactatggatattattaagctttatggt
tcagagcctgcaaactttttagatgtaggaggaggagcaactaaagaaaaagtgtcggca
gcttttaatattattttatctgataaaaacgttaaaggtattttgattaatatttttgga
ggaataatgaggtgtgatgtaattgccgaaggtgtcattgcagccgcaaaagaaacaaat
ctttctgtacctttagttgttagacttgccggaactaaatttgaagaaggaaaaaaaata
ttagaacagtcaggattaaaaattattcctgcaaatgacttgtcagaggctgctcaaaaa
atagttgaggcaataaaataa

DBGET integrated database retrieval system