KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00478Help
Entry
SAR11G3_00478     CDS       T01465                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_00478
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00478
   00640 Propanoate metabolism
    SAR11G3_00478
   00660 C5-Branched dibasic acid metabolism
    SAR11G3_00478
Enzymes [BR:pel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAR11G3_00478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
428977..430137
Genome map
AA seq 386 aa AA seqDB search
MNIHEHQAKDILKKFGAEVPNGEPIFSLDEIDEKFKKIKTDKVVLKAQIHAGGRGKAGGV
KIVDNLEQLKEEAKNLLGKVLVTHQTGPQGREVKRLYIEEASDISKEFYLSCLVDRASSK
IAFISSAEGGMDIEEVANKTPEKITTTRVSLSKGLTKEDITQVLKPYQLPSESIEQAEKL
IQSIFKALLNTDANLIEVNPLILTKENQVLCLDAKINFDANALYRHPDILELRDFDEEDP
AEIEASKYDLAYIKLDGEIGCMVNGAGLAMATMDIIKLYGSEPANFLDVGGGATKEKVSA
AFNIILSDKNVKGILINIFGGIMRCDVIAEGVIAAAKETNLSVPLVVRLAGTKFEEGKKI
LEQSGLKIIPANDLSEAAQKIVEAIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagcatcaagccaaggacattctaaaaaaatttggagcagaagttccc
aatggagagcccattttttcactagacgaaatagatgaaaagtttaaaaaaataaaaaca
gataaagttgtccttaaagcccaaatccatgctggaggaagaggtaaagcaggtggggtt
aaaattgttgataatcttgaacaattaaaggaagaggctaaaaatttactagggaaagtt
cttgtcactcatcaaacagggccccagggtagggaagtaaaaagactgtatattgaagag
gcttcagatatttcaaaagaattctacctatcttgtcttgtagatcgtgcaagttctaaa
attgcttttatttcaagcgctgagggaggaatggatatagaagaagttgctaacaaaact
ccagaaaaaattaccactactcgtgttagtctttctaaaggattaacaaaagaagacata
acacaagtattaaagccatatcagcttccttcagaatctatcgagcaagctgaaaaactt
attcaatctatttttaaggctttgctaaatacagacgcaaacttaattgaagtaaatcct
ttaattctaacaaaagaaaatcaagtattgtgtcttgatgcaaaaattaattttgatgca
aatgcattatatcgtcatccagacattttggaattaagagattttgatgaagaagatcct
gcagaaatagaagcaagtaaatatgatttggcctacatcaaattagatggagaaattggt
tgtatggtaaatggcgcaggacttgccatggctactatggatattattaagctttatggt
tcagagcctgcaaactttttagatgtaggaggaggagcaactaaagaaaaagtgtcggca
gcttttaatattattttatctgataaaaacgttaaaggtattttgattaatatttttgga
ggaataatgaggtgtgatgtaattgccgaaggtgtcattgcagccgcaaaagaaacaaat
ctttctgtacctttagttgttagacttgccggaactaaatttgaagaaggaaaaaaaata
ttagaacagtcaggattaaaaattattcctgcaaatgacttgtcagaggctgctcaaaaa
atagttgaggcaataaaataa

DBGET integrated database retrieval system