KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00481Help
Entry
SAR11G3_00481     CDS       T01465                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_00481
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00481
  Amino acid metabolism
   00310 Lysine degradation
    SAR11G3_00481
Enzymes [BR:pel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR11G3_00481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
433979..435184
Genome map
AA seq 401 aa AA seqDB search
MADKITVPTLGESLTEATVAKWLKKVGDSVQEDEEIVSLETDKVSIDVTAPKSGILSEIV
AKDGATVEVGAHLGSIDASASPAKKKEVQQDKQETTVVEIKKEENILEKKIDNQNKKKEL
SPSVKRIINEKNINIESVDGTGKDGRILKGDLIGLMGFSPAPNTKKIEIGEEERVKMTRL
RSTIAKRLKEAQNNAAILTTFNEIDMSMIIQIRKDNKDEFEKRYGTKLGFMSFFVKACVN
ALQTYPSVNAEVQGEEIVYKNYYNIGVAVGTEKGLVVPVLGNADELSFAEIEKEIITLGT
KAKNNQLSIEELQGGTFTITNGGIYGSMLSTPIINPPQSGVLGMHNIVQRAVVINGKIEI
RPIMYLALSYDHRIIDGKEAVSFLVRVKEILEDPRRLFLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaaattactgtaccaacactaggagaatctttaactgaagcaactgttgca
aagtggttgaaaaaagtaggtgatagtgttcaagaagatgaagagattgtttccttagaa
actgacaaggtaagtattgatgttacggctccaaaatctggaattttgtcggaaattgtt
gctaaagatggagctacagttgaggtaggagcacaccttggctctatagatgcttcagcc
tcacctgccaaaaagaaagaagtgcagcaagataaacaagaaacaacagtggttgagatt
aaaaaagaagaaaatattttagagaaaaaaatagataatcaaaacaaaaagaaagaattg
tctccatctgtaaaacgtataattaatgaaaaaaatattaatatagaaagtgttgatggg
acaggaaaagatggaagaattttaaaaggtgatttgataggacttatgggatttagtcct
gcacccaacacaaaaaaaattgaaatcggagaagaggaaagagttaaaatgactcgtctt
aggtcgacaatcgcaaaaagattgaaagaagctcagaataacgcagcaattttaactacc
tttaatgaaattgacatgtccatgatcattcaaattagaaaagataacaaagatgagttt
gaaaaaagatatggaactaaacttggctttatgtctttttttgtaaaagcgtgcgttaat
gctttgcaaacgtatccttctgtaaatgccgaagttcagggagaagaaattgtttataaa
aactattataatattggagttgcagtagggacagagaagggtttggtcgtacctgttctg
ggaaatgcagatgaactttcatttgccgaaattgaaaaagagattatcactcttggaaca
aaagctaaaaacaaccaattatctattgaagaattgcagggtggaacatttacaatcaca
aatggaggtatatatggatctatgctttctactccaataattaatcctcctcaatctggg
gttttgggtatgcacaatatcgttcaaagggctgtggtaataaatggaaaaattgaaatt
agacccattatgtatcttgctctttcatacgatcatagaattatcgatggtaaagaggcg
gtgtcttttttagtaagagtaaaagaaatattagaagatcctagaagattatttttaaac
ttataa

DBGET integrated database retrieval system