KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00497Help
Entry
SAR11G3_00497     CDS       T01465                                 

Definition
GTP-binding protein Obg (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11G3_00497
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAR11G3_00497
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SAR11G3_00497
Enzymes [BR:pel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SAR11G3_00497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(448407..449531)
Genome map
AA seq 374 aa AA seqDB search
MNILNSKLLIIKIGSSTLVDKTDNFKKDWINKLIDDVHFLIKKKIKVIIVTSGAIALGCK
LLKKNKKKLRLKEHQAIAAVGQIELMNLFKKSFLRKKIKIAQILLTLEDTENRRRSLNAK
DTISNLFEMNIVPIVNENDTTATSEIRYGDNDRLAARVAQIINADTLIMLSDIDGLYSKN
PNQFKDSVYIKKVTEINESIKRIATKSISDYGSGGMITKIEAAKICMDAGCNMLIGSGTI
NNPIQKMIKSKKFTWFVPKINSRNAKKRWIMGTIKTKGSIFVDEGAARAIINGKSLLPVG
ILDTNGTFQRGDTVSIFGDHKKKLGIGVSSYSNSDIKKIKGLKSDQINKILGYSSRGEVI
HIDNLVREEKNEKK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaaattcaaaactattgataattaaaattggctcttctacgttggtagat
aagacagacaactttaaaaaagattggataaacaagttaatcgatgatgtccattttttg
atcaaaaaaaaaattaaagttattatagtaacctctggagctattgccttgggttgcaaa
cttctaaaaaaaaataaaaaaaaattaaggcttaaagaacatcaggctattgctgcagtt
ggacaaatagaattaatgaatttgtttaaaaaatcatttttaagaaaaaaaataaaaatc
gcacagattttacttaccctggaagatacagaaaacagaagaaggtctttaaatgcaaaa
gatactatttctaacctatttgaaatgaatattgttcctattgtaaatgaaaacgatact
acagcgacatctgaaattagatatggagacaatgacagacttgcagcaagagttgctcaa
ataattaatgctgacacactcattatgctttctgatattgacggactgtattctaaaaac
ccaaatcaatttaaggattctgtctatataaaaaaagttacagaaattaatgaatcaata
aaaagaatagcaaccaaaagtattagcgattatgggtcgggtggaatgattactaaaatt
gaagctgcaaaaatttgtatggatgcaggctgtaatatgcttattggatcggggacgata
aacaatcctattcaaaaaatgattaagagtaaaaaatttacgtggttcgttccaaagata
aattcccgtaatgcaaaaaaaagatggattatggggactatcaaaacaaaaggatctatt
tttgtagatgaaggagctgctcgagctatcattaatggaaaaagtttattgccagtagga
atactagacaccaatggtacctttcaaagaggggatacggtatctatttttggcgatcat
aaaaaaaaattgggaataggagtatcctcttactctaatagtgatattaaaaaaattaaa
ggtcttaaaagtgatcagataaacaaaatacttggatattcttcacgtggagaggtaatt
catatagataatttagtaagagaagaaaagaatgaaaaaaaataa

DBGET integrated database retrieval system