KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00497Help
Entry
SAR11G3_00497     CDS       T01465                                 

Definition
GTP-binding protein Obg (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pel01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pel00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(448407..449531)
Genome map
AA seq 374 aa AA seqDB search
MNILNSKLLIIKIGSSTLVDKTDNFKKDWINKLIDDVHFLIKKKIKVIIVTSGAIALGCK
LLKKNKKKLRLKEHQAIAAVGQIELMNLFKKSFLRKKIKIAQILLTLEDTENRRRSLNAK
DTISNLFEMNIVPIVNENDTTATSEIRYGDNDRLAARVAQIINADTLIMLSDIDGLYSKN
PNQFKDSVYIKKVTEINESIKRIATKSISDYGSGGMITKIEAAKICMDAGCNMLIGSGTI
NNPIQKMIKSKKFTWFVPKINSRNAKKRWIMGTIKTKGSIFVDEGAARAIINGKSLLPVG
ILDTNGTFQRGDTVSIFGDHKKKLGIGVSSYSNSDIKKIKGLKSDQINKILGYSSRGEVI
HIDNLVREEKNEKK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaaattcaaaactattgataattaaaattggctcttctacgttggtagat
aagacagacaactttaaaaaagattggataaacaagttaatcgatgatgtccattttttg
atcaaaaaaaaaattaaagttattatagtaacctctggagctattgccttgggttgcaaa
cttctaaaaaaaaataaaaaaaaattaaggcttaaagaacatcaggctattgctgcagtt
ggacaaatagaattaatgaatttgtttaaaaaatcatttttaagaaaaaaaataaaaatc
gcacagattttacttaccctggaagatacagaaaacagaagaaggtctttaaatgcaaaa
gatactatttctaacctatttgaaatgaatattgttcctattgtaaatgaaaacgatact
acagcgacatctgaaattagatatggagacaatgacagacttgcagcaagagttgctcaa
ataattaatgctgacacactcattatgctttctgatattgacggactgtattctaaaaac
ccaaatcaatttaaggattctgtctatataaaaaaagttacagaaattaatgaatcaata
aaaagaatagcaaccaaaagtattagcgattatgggtcgggtggaatgattactaaaatt
gaagctgcaaaaatttgtatggatgcaggctgtaatatgcttattggatcggggacgata
aacaatcctattcaaaaaatgattaagagtaaaaaatttacgtggttcgttccaaagata
aattcccgtaatgcaaaaaaaagatggattatggggactatcaaaacaaaaggatctatt
tttgtagatgaaggagctgctcgagctatcattaatggaaaaagtttattgccagtagga
atactagacaccaatggtacctttcaaagaggggatacggtatctatttttggcgatcat
aaaaaaaaattgggaataggagtatcctcttactctaatagtgatattaaaaaaattaaa
ggtcttaaaagtgatcagataaacaaaatacttggatattcttcacgtggagaggtaatt
catatagataatttagtaagagaagaaaagaatgaaaaaaaataa

DBGET integrated database retrieval system