KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00533Help
Entry
SAR11G3_00533     CDS       T01465                                 

Definition
membrane c-type cytochrome cy
Orthology
K08738  
cytochrome c
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SAR11G3_00533
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAR11G3_00533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(476360..476902)
Genome map
AA seq 180 aa AA seqDB search
MDSFEFNKIAAAVLVTILLLIGVKEVSHVIFHVEKPKQSAYKIEGVETKANTNLVAVKKE
VQLSPITPMLASASIDAGKNKFKKCAACHSAVKGGPNKIGPALWNIVNTKSASQADYKYS
SALKAHGKDWTFEELNKFLIKPSKYIKGTKMAFAGLRKDSDRANVIAYLNSISDNPAPLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatagttttgaatttaataagattgctgcagccgtgctagttactattttactactt
attggggttaaagaagtttcgcatgtaatttttcatgtcgagaagcctaaacaatcagcc
tacaaaatagagggtgtggaaacaaaggctaatacaaatttggtagctgtaaaaaaagaa
gtgcaactgagtcccataactcctatgcttgcatctgccagtatagatgcggggaaaaat
aagtttaagaaatgtgctgcctgtcatagcgcagttaaaggtggccccaacaagattggt
ccagctttatggaatatagtgaatacaaaatcagcttctcaagcagactataaatactca
tctgctctaaaggctcatggtaaagactggacatttgaagagctaaacaaattcttaatc
aagccttctaaatatatcaaaggaactaaaatggcttttgcaggactaagaaaagatagt
gatagagctaatgtaatagcctatctcaatagtataagcgataatccagctcccttaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system