KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00533Help
Entry
SAR11G3_00533     CDS       T01465                                 

Definition
membrane c-type cytochrome cy
Orthology
K08738  
cytochrome c
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pel00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pel02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(476360..476902)
Genome map
AA seq 180 aa AA seqDB search
MDSFEFNKIAAAVLVTILLLIGVKEVSHVIFHVEKPKQSAYKIEGVETKANTNLVAVKKE
VQLSPITPMLASASIDAGKNKFKKCAACHSAVKGGPNKIGPALWNIVNTKSASQADYKYS
SALKAHGKDWTFEELNKFLIKPSKYIKGTKMAFAGLRKDSDRANVIAYLNSISDNPAPLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatagttttgaatttaataagattgctgcagccgtgctagttactattttactactt
attggggttaaagaagtttcgcatgtaatttttcatgtcgagaagcctaaacaatcagcc
tacaaaatagagggtgtggaaacaaaggctaatacaaatttggtagctgtaaaaaaagaa
gtgcaactgagtcccataactcctatgcttgcatctgccagtatagatgcggggaaaaat
aagtttaagaaatgtgctgcctgtcatagcgcagttaaaggtggccccaacaagattggt
ccagctttatggaatatagtgaatacaaaatcagcttctcaagcagactataaatactca
tctgctctaaaggctcatggtaaagactggacatttgaagagctaaacaaattcttaatc
aagccttctaaatatatcaaaggaactaaaatggcttttgcaggactaagaaaagatagt
gatagagctaatgtaatagcctatctcaatagtataagcgataatccagctcccttaaaa
taa

DBGET integrated database retrieval system