KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00538Help
Entry
SAR11G3_00538     CDS       T01465                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pel03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480702..481322
Genome map
AA seq 206 aa AA seqDB search
MNFSTEPDLDELIALVSKLPGLGPKSSRRIALYLLKNRENVMKPLSKSLEKVHAKIIRCN
LCGNIKSKEVKCDIKKCSYSPKNYEQICVVENIADMWAMESTNVFQGHYHILGGTLSALG
NSSPEDLLINSLLNRIKENKIKEVILATSATIEGQTTAHYINDSIKDLGVKVTKLAHGLP
VGGEIEYLDDGTLFSAFKFRSSLVSD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcaaccgaaccagatctagatgaacttatagccttagtttcaaaattacct
ggcctcggaccaaaatcttcaagaaggattgcgctttatttattaaaaaatagagaaaat
gtcatgaagcctctttctaaatcattggaaaaagttcatgcaaaaatcattaggtgtaat
ttgtgtgggaatataaagtccaaagaagtaaagtgcgatattaaaaaatgctcttattct
cccaagaattatgaacagatatgtgtagttgaaaatattgcagacatgtgggctatggaa
agtaccaatgtatttcagggtcattatcacattctaggtggaactctttcagctcttgga
aattcaagtcctgaagatctactcatcaattcattgctaaatcggataaaagaaaacaaa
ataaaagaggtaatacttgcaacttcagctacaattgaaggccaaactacagctcattat
attaacgatagtattaaagatttgggtgtaaaagttacgaaattagcacatgggttgcct
gtaggtggtgaaattgagtatttagatgacggaactttattctcagcttttaaattcaga
agttccttagtttctgattaa

DBGET integrated database retrieval system