KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00542Help
Entry
SAR11G3_00542     CDS       T01465                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11G3_00542
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAR11G3_00542
Enzymes [BR:pel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAR11G3_00542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(483517..484677)
Genome map
AA seq 386 aa AA seqDB search
MAKIINELSFTKELIKIPSVTPIDAGAIDLVTKRLKSLGFKCTILNFKDKNTPPIKNLYA
RLGTSSPNFCFAGHTDVVPTGNAKSWDAGPFSGIVKNGKIYGRGASDMKGGIACFIAAVS
EFIKDQKKFKGSISFIITGDEEGVAINGTKKVVNYLKKKKEKIDFCIVGEPSNRKVLGQM
MKIGRRGSITTHLTLSGIQGHVAYPHEACNPSTPLIKILDKLKSTKLDNGTNNFQPSNLE
ITKIGTDSHADNVIPATSSATFNIRFNNKHNHSSLKKKISTIVQTIAKKYKCKPIVKFSE
TGTAFITKPGETVRMMSQVIKKITNKKPVLSTSGGTSDARFIKDIAPCVEFGLVGNTMHK
INECVSVNDLKKLKKIYYKVLETYFK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattattaacgaactttcattcactaaagaactaatcaaaataccaagtgtt
acaccgattgatgcgggagcaattgatcttgttacaaagcgacttaaatctctagggttt
aaatgcacaattcttaactttaaagataaaaatacacctcccataaaaaacctatatgcg
agactgggcacatcttctcccaatttttgttttgcaggacatactgatgtagttccaaca
ggaaacgcaaagtcttgggatgcgggtccattttcaggaatagtaaaaaatggaaaaatt
tatggaagaggcgctagcgatatgaagggtggaattgcttgctttattgctgcagttagc
gaatttataaaagaccaaaaaaaatttaaaggttcaattagttttattattactggagac
gaagaaggagtagccatcaacggaaccaaaaaagtggtgaattatttaaaaaagaaaaaa
gaaaaaattgacttttgtattgtcggagaaccttctaatagaaaagttttaggacaaatg
atgaaaatagggagaagaggaagtattacaacacatctaaccctatcaggaattcaaggc
catgttgcttaccctcatgaagcatgtaacccttctactcctttaataaaaatactagat
aaattaaaatcaactaaattagataatggaacaaataattttcaaccttcgaatttagaa
attaccaaaattgggactgatagccatgctgacaatgttattccagcaacttcctctgca
acttttaatattagatttaacaacaagcataaccactcttctttaaaaaaaaagatttct
actatcgttcagacaatagccaaaaaatataagtgcaaacctattgttaaattttcagaa
actggaacagcctttattacaaagccgggagagaccgtacgcatgatgtctcaagtaatt
aaaaaaattacaaataaaaagccagttctttccaccagtggtggaacttctgatgcaaga
tttattaaagacattgctccctgtgtagaatttggcttagttggcaacactatgcataaa
attaatgaatgtgtgtccgtaaatgatttaaaaaaattaaaaaagatatactacaaagta
ttagaaacttactttaagtaa

DBGET integrated database retrieval system