KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00588Help
Entry
SAR11G3_00588     CDS       T01465                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11G3_00588
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11G3_00588
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR11G3_00588
Enzymes [BR:pel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR11G3_00588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(518269..519189)
Genome map
AA seq 306 aa AA seqDB search
MHALICKRAGKKYIVGDTGAGYAGKMLSMAAKKFGLKCKIFMGAKDIIRQKPNCDAIRKN
GAEIIPVYSGSQTLVDAVSECMRYWVSNCDTTHMAVGSTVGPNIFIKICAWSTAQISREL
IIQMNKEFGQIPKKLKLINCVGGGSSAAGFWNEFMDYNKQQVEFVGVEAGGPKKSKLHAA
PLTNGSKIGILHGAAQYVIQDKDGQIGETSSISAGLDYPGISPLHCFLKDARRARYTSAT
DEEALQAYKLVSKLENLSPSLEPSHAFAEAIKIAPKLNKNTIICVNSCGDAKKDRAIIKK
RLGFFK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgctcttatttgcaaacgtgctggtaaaaaatatattgttggagatactggtgct
gggtatgctgggaaaatgcttagtatggctgcaaagaaatttggtcttaaatgtaagatc
tttatgggagctaaggatattatacgtcaaaaaccaaactgtgatgctatcagaaaaaat
ggtgccgaaataattccagtatattcaggcagccagacattagttgatgccgttagcgag
tgtatgagatattgggtttctaattgtgacactactcatatggcagtaggaagcaccgtt
gggcctaatatttttattaaaatatgcgcttggagtacggctcaaatatcaagagaactt
attattcaaatgaataaagaatttggacagattccaaaaaaattaaaattaattaattgt
gtaggtggtggaagctccgctgctggattttggaatgaatttatggactataacaaacaa
caagtagagtttgttggggtggaggctggtggcccaaagaaaagtaagcttcatgcagca
cctctcaccaatggttctaaaattggaattttgcatggcgctgctcaatatgtaattcaa
gataaagatgggcagattggggaaacatcttctataagtgcgggtctagactatcctggt
atttccccactgcattgttttttaaaagatgccagaagagcgaggtatacttccgcaaca
gatgaagaggcactccaggcatataagctagtttcaaaattagaaaatctatccccttct
ttagagccatctcatgctttcgcagaagcaattaaaattgctcccaaactaaacaaaaat
acaatcatttgtgtaaatagctgtggagatgccaaaaaagatagggctattattaaaaag
agacttgggttttttaaatga

DBGET integrated database retrieval system