KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00621Help
Entry
SAR11G3_00621     CDS       T01465                                 

Definition
(GenBank) pyruvate dehydrogenase E1 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00010  Glycolysis / Gluconeogenesis
pel00020  Citrate cycle (TCA cycle)
pel00620  Pyruvate metabolism
pel01100  Metabolic pathways
pel01110  Biosynthesis of secondary metabolites
pel01120  Microbial metabolism in diverse environments
pel01130  Biosynthesis of antibiotics
pel01200  Carbon metabolism
Module
pel_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_00621
   00020 Citrate cycle (TCA cycle)
    SAR11G3_00621
   00620 Pyruvate metabolism
    SAR11G3_00621
Enzymes [BR:pel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAR11G3_00621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT TFX_C
Motif
Other DBs
NCBI-ProteinID: AEA81096
UniProt: F2I091
Position
complement(552686..554008)
Genome map
AA seq 440 aa AA seqDB search
MSNDILVPNIGDFNNVEIIEVLIKEGQEIEKGDTVITLESDKSSVEVPSNISGIVKVVHI
KIGDKVSEGSLVASLEGTIESTKINLPDSENKKNIEDKDKVDELKNSIITQPTTNVIGGG
TVSAQSVVFSNNGVGVSGASPKIMKFARELGISVNDISGSGRQGRVLEQDIKNYVGQNLN
KNKIEENDTLSSKTEKVDSDALPYQHNEFGDVDVQTIPRIKKMSGPHLVRAWNTIPHVTQ
HDELDITEMESFRKGLVNLNTREKISITPLAFMMKALVNGMQRFTNFNSSLDQDKVVYKK
YFHIGVAVDTPHGLMVPKIRDVNTKSLSDLSKEVRSVSKLCKELKIDKKEFFGGSMTISS
LGGIGGSFFTPIINSPEVAIIGMGKSEIKPVFINGKFEPRMMMPISLSYDHRIIDGAEAA
KFCQDLKISLGRNFAVNLAI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgatattttagttcctaatattggtgactttaataatgttgaaattattgag
gttctaattaaagaaggtcaagaaatagaaaaaggagatactgttattacgcttgaaagt
gacaagtcaagtgtagaggttccttcaaatatttctggaattgtcaaagtcgttcatata
aaaattggtgacaaggtttctgaaggaagtttagtagcttcgctagaaggtactatagaa
tctaccaaaataaatctacccgattccgaaaataaaaaaaatatagaagataaagataaa
gtagatgagttaaaaaattcaattattacccagcctaccacaaatgtgattgggggggga
acagtttctgcccaatcagttgtattctctaataatggtgtaggtgtttctggagcaagt
ccaaaaattatgaagtttgcaagagagctgggaatttctgtcaatgatatttctggaagt
ggtagacaaggaagagttctagagcaggatattaaaaattatgttggccaaaatttaaac
aaaaacaaaattgaagaaaatgacactttgagctcaaaaactgaaaaagtagattcagat
gctcttccatatcaacataatgaatttggtgatgttgatgttcaaacgattcctagaatt
aaaaaaatgtccggtccacacttggttagggcctggaatacaattccacatgtaactcaa
cacgacgagctagatattacagaaatggaaagctttagaaaaggattggtaaatttaaat
acaagagagaaaatttcaataacaccattagcttttatgatgaaagccttggttaatggt
atgcaaagatttacaaacttcaatagctccctagaccaagataaagttgtttataaaaaa
tattttcatattggagttgctgttgatactccacatggcttgatggtaccaaaaattcga
gacgtgaacacaaaaagcctttccgacttgagtaaagaagtgaggtccgtaagtaaactt
tgtaaagaattaaagattgataaaaaggaattttttggaggttcgatgacgatttctagt
ctaggaggtatcggaggaagtttttttacacccattattaactctcctgaagtcgcaata
ataggaatgggaaaatccgagataaaaccagtatttattaatggaaaattcgagccaaga
atgatgatgccaatttctttatcttacgatcacagaataattgatggtgctgaagctgca
aaattttgtcaggacttaaagattagtcttggaagaaactttgctgtgaatctggctatc
tag

DBGET integrated database retrieval system