KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00632Help
Entry
SAR11G3_00632     CDS       T01465                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11G3_00632
  Amino acid metabolism
   00340 Histidine metabolism
    SAR11G3_00632
Enzymes [BR:pel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAR11G3_00632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563140..564438
Genome map
AA seq 432 aa AA seqDB search
MKYILSTKDKNFQNNFKKVLNSKRRQSEINRAVVLKIIKDVQKNGDQSLIKYSKKFDKIS
LNKKNIQLSQKEIVSITKKLDPKIKQAINLAYARVKSFHLRQVNKSFKFNDKYGNQLAYK
YTPLDKVGIYVPGGKASYPSTVIMNSVPAIVAGVKNIYATVPAPNNTINAGVIYAAKVCG
IKKIFKVGGAQAIAALTYGTKTIDKVDKIVGPGNIFVATAKKEVFGQVGIDMIAGPSEIT
VIAGPENNPTWTALDLLSQAEHDELSQSILITKNSSFANKVNNEVKKIIQILPRAKIAKL
SIKNYGTIVVCKSDKEIIDITNQIAPEHLEIKVKNYNSIEKRIINAGSIFLGDYSPEAIG
DYIAGPNHVLPTSGTARFASGLSVADFYKKTSVIKCSKLGIKKIGPAAIRLANYEGLQAH
ALSIKTRIINNK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatattaagcactaaagataaaaattttcaaaataattttaaaaaagtacta
aattcaaaacgccggcaatcagaaataaacagagctgtagttttaaaaattataaaagat
gttcaaaaaaatggagatcagtctttaattaaatattcaaagaaatttgataaaatttca
ttaaataaaaaaaatattcaattaagtcaaaaagaaatagtttcaataacgaaaaaacta
gatcctaaaattaaacaagctattaaccttgcgtacgctagagttaagtcatttcactta
aggcaagttaataagtcttttaaatttaatgataaatatggaaatcaattagcttacaaa
tatacaccactagacaaggtaggaatttatgttccaggtggaaaagctagttatccaagc
actgtaattatgaattcggttccagcgattgtggcgggtgttaaaaatatttatgcaacc
gtaccagctcctaacaatacaattaatgctggagtgatttatgctgctaaagtatgtgga
attaagaaaatttttaaagttggaggagcacaggctattgctgccttgacttatggaact
aagactattgataaagttgataaaattgttggtcctggcaatatatttgtagcaacggct
aaaaaagaagtatttggacaagttggaattgacatgattgcaggaccgtcagaaataact
gtaattgcaggaccagaaaataatcccacatggacagcccttgatcttttatcccaagca
gaacacgatgaattatctcaaagtattctgataactaaaaactcatcatttgcaaataaa
gtaaataatgaagttaaaaaaattattcaaattttacctagagctaaaattgcaaaatta
agtataaaaaattatggaacaatcgttgtctgcaaaagtgacaaagaaataatcgatatt
actaatcaaattgctcctgagcatttagagataaaagttaaaaactataattcgattgaa
aaaagaattattaatgctggatctatttttttaggagactacagtccggaggcaatcgga
gattatatagctggtccaaatcatgtactacccacatcgggaacagccaggtttgcatcg
gggttgtctgttgctgacttttataaaaaaacatctgtaatcaagtgttctaagcttggt
ataaaaaaaataggaccagctgctataagacttgcaaattatgaaggcttgcaagcccac
gctctttcaattaagacacgtattattaataataagtaa

DBGET integrated database retrieval system