KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00684Help
Entry
SAR11G3_00684     CDS       T01465                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR11G3_00684
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11G3_00684
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAR11G3_00684
Enzymes [BR:pel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAR11G3_00684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605155..606558
Genome map
AA seq 467 aa AA seqDB search
MLYFSTRDKQRTFSFKEVFLNALASDGGLYVPTSIPKFSPEKIQSMKNYTFQEMSYEIFN
VFVGDAFSPEELKGIISKSYSVFRNEKIVDLKLIDNISCVELFHGPTLAFKDIAMQVLGN
MYENLLNKSKNKMNLITATSGDTGAAAIDALKSKKYLNIFVLHPENKISETQRRLMTTVL
DKNVYNIAIKGTFDDCQYLVKEMFNDQKFRSNIQMSGVNSINWARIVAQIVYYFFIYLSQ
KETEKRMVVSVPTGNFGDIYAGYIAKQMGLPIEKLIIASNHNNLLEKCLSTGLYQPSKVN
PSVSPSMDIQVASNFERILFEICNQDESRVVALMKNLKNKKEFQLNKTELSNLQENFLAH
SVSEEETLQTIKQVYQEHNSVLDPHSAIGFKALKKLSSLSNNFSYFCFETAHPCKFPDAI
VSAIGKEPPMPDFVKKIFSKEESFVVLDGNLEILKSYIEKKVSNNSS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgtattttagtacaagagacaaacaaagaactttttcattcaaagaagtgttcctt
aatgctttggcgtcagatggtggtctttatgtaccaacaagtattcctaaattcagtcca
gaaaaaattcaatcaatgaaaaattatacatttcaagaaatgtcgtacgaaattttcaat
gtatttgttggagatgccttttccccagaggaacttaaaggcattatcagtaaatcatat
tcagttttcagaaacgaaaaaattgttgatctaaaattaatagataatatttcttgtgta
gaactctttcatggaccaactctcgcattcaaagatatcgcaatgcaagtgctaggtaat
atgtatgagaatctattgaataaaagtaaaaataaaatgaacttaattacagccacttct
ggtgatacaggagctgcagctattgatgccctgaaaagtaaaaaatatttaaatattttt
gttttgcatcctgaaaataagatttcagaaacacaaagaagacttatgacgacagtgcta
gacaagaatgtctacaatattgcaattaaaggaacatttgatgattgccagtatttggtc
aaagaaatgtttaatgatcaaaaatttagaagcaatattcagatgtctggagttaattca
attaactgggcaaggatagtagctcaaatagtttattatttttttatttatttaagtcag
aaagaaacagaaaagagaatggtagtttctgttcctacaggaaactttggtgatatttat
gcagggtatattgccaaacaaatggggcttcctatagaaaagttaatcatagcaagtaat
cataacaacttattagaaaagtgtttaagtacaggattgtatcaaccttccaaagtgaac
ccctccgtttcacctagtatggacattcaagtggcgagcaattttgaaagaatattattt
gaaatatgcaatcaagatgaatctagagtagtagctctgatgaaaaacttaaaaaataaa
aaagaatttcaattgaataaaactgaactttctaaccttcaggaaaattttttagcgcac
agtgtatctgaagaagaaacattacaaacaattaaacaggtttatcaagaacacaattct
gttttagatccacattcagccatcggatttaaagcattaaaaaagttaagtagtttatct
aataatttttcatatttttgctttgaaacagcccatccttgcaaatttcctgatgcaatc
gtgagtgctataggcaaggaaccacccatgccagattttgtgaaaaaaatattttcaaaa
gaagagagttttgtagtcttggacggtaatttagaaatattaaaaagttatatagaaaaa
aaagttagcaacaactctagctga

DBGET integrated database retrieval system