KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00753Help
Entry
SAR11G3_00753     CDS       T01465                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pel00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pel00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668039..669433
Genome map
AA seq 464 aa AA seqDB search
MQVIQKIINSNNCSADTRTLRKSEIFFDLGSKSNKDGDYFFKALKKKPLFIITQNQKRNL
SGKNFIIVKNIYSFYVKSISLKFKKKPKYKIAVTGTNGKTSVAFFYYKILNLLGIKVGSI
GTLGVFENTKKSKGNLTTPDFFSNHKNLNHFYKKRINHSIIEASSHGLKQNRLEKINFDC
GIFTNLTHDHLDYHRTMKDYLNSKLILFKKLIKKNGFLVTGSEVLEFSLLNKISKNKKLN
LLSYGRKGNIIKIISSKPNGQFTKLKINILGKVHTLKLKLIGNFQIENFLAATLACYSSG
ISFEKIFRICSRIDNPPGRLQLFKKQNKTVIIDYAHTPDALEKTIIEIQKFFNKKINIVF
GCGGDRDHQKRKAMGKIAYKLCNKIYITDDNPRYENARKIRMQIKAGCPNAIVVPSRKQA
IKSSISMLNEEILLIAGKGHEEFQLIKNKKIAFSDHHCVTRYLK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcatacaaaaaataattaattccaataattgctccgcagataccaggactctg
agaaaaagtgaaattttttttgatttaggaagtaaaagcaataaagacggagattatttt
tttaaagccttaaaaaaaaagccattatttattataactcaaaatcaaaaacgaaaccta
tctggtaaaaattttattattgtaaaaaatatttactctttttacgttaaaagcattagt
ctgaaatttaaaaaaaagcctaagtataaaattgcagtcacaggtactaatggaaaaacg
tcagtagcatttttttattataaaatacttaatctacttggaataaaagttggttccata
ggaactttaggagtatttgagaacacaaaaaaaagtaaaggaaatttaaccactccagat
tttttttctaatcacaaaaatctaaatcatttctacaaaaagagaattaaccattcaata
attgaagcttccagtcacggcttaaaacaaaataggttagaaaagattaattttgactgt
ggtattttcacaaatttaacacacgatcatttggactaccatcggactatgaaagattat
ctaaattctaaattaatcctttttaaaaaactaattaaaaaaaatggatttttagtaaca
gggagtgaagtattggaattttccctattgaataaaatttcaaaaaataaaaaattaaat
ttattatcttacggtagaaaaggaaatattataaaaataatatctagtaagcctaatggt
caatttacaaaattaaaaataaatattttgggaaaagtccataccttgaaattaaagttg
attggaaattttcaaattgaaaattttttagctgccacacttgcttgctattcatctggt
attagttttgaaaaaatatttagaatatgctctagaattgacaatcctcccggcagattg
cagttatttaaaaaacaaaacaaaactgttattattgattatgcacacacaccagatgcc
ttagaaaaaacaattattgaaattcaaaaattttttaacaaaaaaataaatattgtcttt
ggttgtggtggggacagggatcatcaaaaaagaaaagcaatgggaaaaattgcatacaaa
ttatgtaacaaaatatatataaccgatgataatccgaggtatgaaaatgcaagaaaaata
agaatgcaaattaaagcagggtgccccaacgcaattgtagttccatctagaaagcaggca
attaaaagctctatctctatgctaaatgaagaaatcttattaattgctggaaaaggacac
gaggagtttcagttaattaagaacaaaaaaatagctttttctgaccatcattgcgtaaca
agatacttaaagtaa

DBGET integrated database retrieval system