KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00837Help
Entry
SAR11G3_00837     CDS       T01465                                 

Definition
(GenBank) GTP cyclohydrolase I type 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00790  Folate biosynthesis
pel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR11G3_00837
Enzymes [BR:pel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SAR11G3_00837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AEA81312
UniProt: F2I2C6
Position
747287..747889
Genome map
AA seq 200 aa AA seqDB search
MKNVTDIKDKILEKISKDEAEKAIKTILKFVGENPDREGLVETPKRVIKAFQEYFGGYLI
NPDDYLEKTFGDVEGYDDMVIQKNITIHSHCEHHMAPIIGTVHVAYVPSEKVVGLSKLAR
VVDAYARRLQTQERLTMQIANSIYKGLKSHGSAVSIDAEHQCMTTRGVRKEGATTITNYF
TGVFRDSQNLQKRFLSYIKD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtaacagatataaaagataaaattttagaaaagatttctaaagacgaggct
gaaaaagctattaaaactatattaaaattcgttggagagaaccctgatagggagggttta
gtagaaactccaaaaagagtaattaaagcatttcaggagtattttggaggttatctaatc
aatcctgatgattatctagaaaaaacttttggagatgtggagggctatgatgacatggtg
atacaaaaaaacattactattcatagtcattgcgaacaccatatggctcccattattgga
actgtacacgttgcctatgttccttctgaaaaagtagtaggcttaagcaagcttgcaaga
gtagtagatgcgtatgctagaagattgcaaactcaagaacggttaactatgcaaattgcc
aattctatttacaaaggtttgaaatcccatggatctgcagtgagtatagatgcggagcat
caatgtatgactacacgaggagttagaaaagaaggagcaacaactatcactaactatttc
acaggagtatttcgtgacagtcaaaatcttcaaaaaagatttctatcctacataaaagat
taa

DBGET integrated database retrieval system