KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00857Help
Entry
SAR11G3_00857     CDS       T01465                                 

Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SAR11G3_00857
Enzymes [BR:pel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SAR11G3_00857
Transfer RNA biogenesis [BR:pel03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SAR11G3_00857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762699..763478)
Genome map
AA seq 259 aa AA seqDB search
MKKLSKKNYPTIVKKLLPFFVKAGKKSIELSGKKLKIFIKSDQTPVSNGDLAVDKILQDA
IRLITPDIEIVSEETVENNKVGIRTTFWLIDPIDGTSSYIKNKDEYTLNAALIVNRKPVI
GIVFAPKKKRLFYSYGKGHAYEIKNNKKIKLQCNLIKKNAVAALMNSSKPSKIIKKILTK
HKATTFLDVGSSYKFCLIASGEFDIYAARPRAKEWDIAAGHALAEHAGAVVSTHQHKTIV
YGKPRFYNPSLLVRRSKNI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgagtaaaaaaaactacccaactatcgtaaaaaaactattacctttcttt
gttaaagcaggaaaaaaatctattgaactatcaggtaaaaaattaaaaatatttatcaaa
tcagaccaaacacctgtttccaatggagatcttgctgtagataaaattttacaagatgcc
attagattgattactcctgatattgaaattgtctctgaagagactgttgaaaataataaa
gtaggtatacgaacaaccttttggttaattgatcctatcgatggaacaagctcttacata
aaaaataaagatgaatatactttaaatgcggcgttaattgtaaacaggaaaccagttata
ggaattgtatttgcacctaaaaagaaaagattattttattcctatggcaaagggcatgct
tatgaaattaaaaataacaaaaagattaaactccaatgtaatttaataaaaaagaatgct
gtagctgcattaatgaactcatccaagccctctaagataatcaaaaaaatactaacaaaa
cataaagccactacttttttagatgttggaagttcttacaaattttgtttaattgcttct
ggagaatttgatatttatgccgctagacctcgagctaaagagtgggatatagcagcaggt
catgcgctagcagagcatgctggtgcagttgtttcaacccatcaacataaaaccattgtt
tatggaaagcctcgtttttacaacccctctttacttgttaggagaagtaaaaatatttaa

DBGET integrated database retrieval system