KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00882Help
Entry
SAR11G3_00882     CDS       T01465                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAR11G3_00882
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAR11G3_00882
Enzymes [BR:pel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SAR11G3_00882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785384..786685
Genome map
AA seq 433 aa AA seqDB search
MLDFKKIISSIADVGKGILGKKFSEKRDLPTLVQLCDDLISYKGTASGIAIAREISEIYK
ILDKEQKLNFFLTINEKFKPNLKSIDEEISTYSKDKSKFNLDNLGNTIEGNRQELIRRMN
MAPDGTSVLVSMREDLIDFSKTNVELKDFDQDMRHLFKSWFNPGFLRLERITWETKAAVL
EKIIKYEKVHKILDMNDLKRRLQEDRRFFAYFHPVLADEPLIFVQVAFGDGLGKSIQDIM
KPITGNFEKSNTATFYSISNCQEGLMRVTLGNFLIKRVVHEIQSENSNIKNFGTLSPLPG
FADWFKSLSDNKLANILKNYDIAKVAFLKSDTVKLGDQRIVEEKEAIKKIVVHYLLNEKN
KNQPLNPVSRFHLGNGASIEDVIINGNVSDYGYQESFGIMVNYIYHLNKLEKIHEDFASK
KIISYSDKIKKYV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctggattttaaaaaaattataagttccattgctgatgttggaaaaggcatattagga
aaaaaattttctgaaaaaagagacttgccaaccttggtccagctttgtgatgatcttatt
tcatacaaaggaaccgcttcaggaattgcaattgcaagagaaattagtgagatttataaa
attttagacaaagagcaaaagttaaatttctttttaactatcaatgaaaaatttaagcca
aatttaaaatcaattgatgaggaaatatctacttactcaaaagataagagtaaattcaat
ttagataatttaggaaatactatcgagggaaatagacaagagcttattcgtagaatgaac
atggctccagacggaacatctgtattagtgtctatgcgtgaagacttaattgattttagc
aaaactaatgtagagttaaaagactttgatcaagacatgagacatctgtttaagtcttgg
tttaatcctggctttttaaggttagaacgcattacctgggaaaccaaagctgcagtctta
gaaaaaataattaaatatgaaaaagttcataaaattttagatatgaatgatttaaaaaga
agattgcaagaagatagaagattttttgcatattttcacccagttctagcagatgaacct
ttgatttttgtacaagtagcatttggagatggtcttggaaaatcaatacaagatattatg
aaacctattacaggaaattttgaaaaatctaatactgcaacattttactcaattagcaat
tgccaagaaggcctgatgagagttactttgggaaattttttaattaaaagagtagtacat
gaaattcaatcagaaaattctaacatcaaaaattttggtacgttatctcccttacctggg
tttgcagattggtttaaaagtttaagtgataataaattagcaaatatcttaaaaaattac
gatatagcaaaagttgcctttctaaaatcagatacggtaaaacttggagatcaaagaatt
gtagaagaaaaagaagctattaaaaaaatcgtcgtgcattatttgcttaatgaaaaaaat
aaaaatcaacctctaaatccggtttcaagatttcaccttggtaatggagcaagcatagaa
gatgtaattatcaacggaaatgtatctgattatggctaccaagaatcttttggaattatg
gtaaattatatttatcatttaaataaattggaaaaaatccacgaagactttgctagtaaa
aaaattatttcttactctgataaaattaaaaaatatgtctaa

DBGET integrated database retrieval system