KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00935Help
Entry
SAR11G3_00935     CDS       T01465                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00230  Purine metabolism
pel01100  Metabolic pathways
Module
pel_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAR11G3_00935
Enzymes [BR:pel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SAR11G3_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RNA_helicase AAA_22 ABC_tran PRK Zeta_toxin Thymidylate_kin NB-ARC cobW Cytidylate_kin2 MobB RsgA_GTPase AAA_16 AAA_17 DUF2524 AAA
Motif
Other DBs
NCBI-ProteinID: AEA81410
UniProt: F2I2E5
Position
829785..830414
Genome map
AA seq 209 aa AA seqDB search
MRIAHLNKFFVKRKKRGVLIVISSPSGAGKTTIAKKLVSKKLNIELSVSLTTRKPRSNEI
NKVDYHFVSKKFFQTKIKQKHFLEHAKVFDNFYGTSQKEITNKLSKGKNILLDIDWQGAR
QVRKKKATDTVSIFILPPSLKVLKQRLMKRESSLAFVNNRMSKAKKEIAHWNEYDYAVVN
KDLKQCLKEIKKILEIQKHKSSGKTILKF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgagaatagcacatctaaataagttttttgttaaaagaaaaaaaaggggagttctgatt
gttatttcctccccttcgggtgcgggtaaaactactatagccaaaaaattagtttctaaa
aaactcaacatcgaactttcggtatccctaaccactagaaaaccaagatctaatgaaatc
aataaagtagattatcattttgtatccaagaaattttttcaaacaaagattaagcaaaaa
cactttctagaacatgcaaaagtatttgataatttttatggaacgtcccaaaaagaaatt
acgaacaagctaagcaaaggcaaaaatatcctattggatattgattggcaaggtgcaagg
caggtcagaaaaaaaaaggcaactgataccgttagtatatttattctacccccatcctta
aaggttttgaaacaaagattaatgaaaagagaatctagcttggcatttgttaataataga
atgagtaaagctaaaaaagaaatagcgcattggaatgagtatgactatgcagttgttaat
aaagacttaaaacaatgtttaaaagaaattaaaaaaattttagaaatacaaaagcacaaa
tcatctggaaaaactattttaaaattttaa

DBGET integrated database retrieval system