KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01048Help
Entry
SAR11G3_01048     CDS       T01465                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAR11G3_01048
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAR11G3_01048
Enzymes [BR:pel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     SAR11G3_01048
Amino acid related enzymes [BR:pel01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SAR11G3_01048
Transfer RNA biogenesis [BR:pel03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAR11G3_01048
 Prokaryotic Type
   Other AARSs
    SAR11G3_01048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(928066..929442)
Genome map
AA seq 458 aa AA seqDB search
MNNKIVVRFAPSPTGPLHIGGARTALFNWLFAKNHEGKCLLRIEDTDKERSKKEYEKQIL
DTLDWLGINPDEKPFSQSLNLKKHIEIAETLLKNSSAYKCYCTTEELEQEKKSSREKNLP
YIYSGKCRNKGEAKRPFIIRFKSNQIGTEELDDLVQGKITISNSTIEDFVIVRTDGTPTY
QLSASVDDFLMNITHVIRGDDHKINTFKQTQIFKAMEWPVPRYAHIPLIHSKEGKKLSKR
DGAATVEDYEKIGILPESLRNYLLRLGWSHKDKEIFSLEESIKLFNLDGVGKSPSKLDMD
RILSINETYMKNSDRKKIFENFCDYTKKFKDPIDKEFLKKIEDNFLVFLNKAKTLENIYE
NAKFIFNYKKIEFSDLISENEKKIIQLFLQKIDKVSDSNVEKIKAIIDEVIVEEKIKFKD
FGQPIRIVLTGTKFAPSITDIIQSLGIGEVKRRISLYL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaattgtagttcgattcgcaccctctcctactggtcctttgcacataggt
ggcgcacgtactgctctattcaattggctttttgcaaaaaaccatgagggaaaatgtcta
ttaagaattgaggacactgataaagaaaggtcaaaaaaagaatatgaaaaacagattttg
gacactttggattggctaggtatcaatccagatgaaaaaccatttagtcaaagtttaaac
ttaaaaaaacatatagaaattgccgagacgttacttaaaaatagcagcgcttataaatgc
tactgcaccacagaagaattggagcaagaaaaaaaaagttctagagaaaaaaatctacca
tatatttatagtggaaaatgccgaaacaaaggagaggcaaaaagacctttcataataaga
ttcaaatcaaatcaaattggaacagaagaattggatgatttggttcaagggaaaattact
atttccaattctactattgaagactttgttattgtaagaactgacggaacgccaacttac
caactttctgcatctgtagatgattttttaatgaatataacacacgtgattagaggtgat
gatcataaaataaatacgtttaagcaaactcaaatatttaaggctatggagtggcctgtt
cctagatatgcacatatccctttaattcattcaaaagaagggaaaaagctatccaagaga
gacggtgctgcaactgttgaagattatgaaaaaataggcattttgccagagagcctaaga
aactatcttttaagacttggatggtcccacaaagacaaggaaattttttctttagaagag
agtatcaaactatttaatttagatggagtgggaaaatcaccctctaaattagatatggac
agaattttatcaattaacgaaacttatatgaagaattctgatagaaaaaaaatatttgaa
aatttctgtgattatactaaaaaatttaaagatcctatcgacaaagagttccttaaaaaa
attgaagataatttcttagtcttcttaaataaagcaaagactttagaaaatatttatgaa
aatgctaaatttatttttaattacaaaaaaattgaattcagcgacctaatttcagaaaat
gaaaaaaaaataattcagctttttttacaaaaaatagataaagtttccgacagtaatgtt
gaaaaaataaaagctattattgatgaagttattgtagaagaaaaaattaaatttaaagat
tttggacaacctataagaattgttttaacaggaactaaatttgccccatccattacagat
attattcaatctcttgggattggtgaggtaaaaagaagaatatccttgtatctttga

DBGET integrated database retrieval system