KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01058Help
Entry
SAR11G3_01058     CDS       T01465                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_01058
   01230 Biosynthesis of amino acids
    SAR11G3_01058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_01058
   00051 Fructose and mannose metabolism
    SAR11G3_01058
   00562 Inositol phosphate metabolism
    SAR11G3_01058
Enzymes [BR:pel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAR11G3_01058
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAR11G3_01058
  Exosomal proteins of bladder cancer cells
   SAR11G3_01058
  Exosomal proteins of melanoma cells
   SAR11G3_01058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935718..936254
Genome map
AA seq 178 aa AA seqDB search
MSFGAATGSISASMVKTSGAEYVILGHSESRSSGDSLLIIKNKILHADKTKLKIIFCMGE
TLSQKKRSQSLAVLKKQIIGSVTKKINFNNIIFAYEPVWSIGTGLVPSPEYLEKTFLFLN
SYLKNNFKIKSPKILYGGSVNPANIKGLRSIKACSGYLVGGASLKAKNFIEIIKNYYN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgagctttggtgcagctacaggatctattagtgcctccatggtaaaaactagtggagct
gaatatgtaattttgggtcattcggaatcaagatcttctggcgatagtcttttgataatt
aaaaacaaaatactacatgcagataaaacgaaattaaaaataattttttgcatgggagaa
accttgagccaaaaaaaaaggagccagtccttggcagttttaaaaaaacaaattatagga
tctgtgactaaaaaaataaattttaataatataatatttgcctacgagccagtttggtct
ataggcacggggcttgttccttcgccagaatatcttgaaaaaacatttttatttttaaat
agctatttaaaaaataattttaaaattaaatctccaaaaattctttatggaggatctgtg
aaccctgcaaatattaaaggtttgagatctattaaggcctgttctggctatttggttggt
ggagcttctttaaaagcaaagaatttcattgaaattattaagaattattataattag

DBGET integrated database retrieval system