KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01058Help
Entry
SAR11G3_01058     CDS       T01465                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR11G3_01058
   01230 Biosynthesis of amino acids
    SAR11G3_01058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_01058
   00051 Fructose and mannose metabolism
    SAR11G3_01058
   00562 Inositol phosphate metabolism
    SAR11G3_01058
Enzymes [BR:pel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAR11G3_01058
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAR11G3_01058
  Exosomal proteins of bladder cancer cells
   SAR11G3_01058
  Exosomal proteins of melanoma cells
   SAR11G3_01058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935718..936254
Genome map
AA seq 178 aa AA seqDB search
MSFGAATGSISASMVKTSGAEYVILGHSESRSSGDSLLIIKNKILHADKTKLKIIFCMGE
TLSQKKRSQSLAVLKKQIIGSVTKKINFNNIIFAYEPVWSIGTGLVPSPEYLEKTFLFLN
SYLKNNFKIKSPKILYGGSVNPANIKGLRSIKACSGYLVGGASLKAKNFIEIIKNYYN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgagctttggtgcagctacaggatctattagtgcctccatggtaaaaactagtggagct
gaatatgtaattttgggtcattcggaatcaagatcttctggcgatagtcttttgataatt
aaaaacaaaatactacatgcagataaaacgaaattaaaaataattttttgcatgggagaa
accttgagccaaaaaaaaaggagccagtccttggcagttttaaaaaaacaaattatagga
tctgtgactaaaaaaataaattttaataatataatatttgcctacgagccagtttggtct
ataggcacggggcttgttccttcgccagaatatcttgaaaaaacatttttatttttaaat
agctatttaaaaaataattttaaaattaaatctccaaaaattctttatggaggatctgtg
aaccctgcaaatattaaaggtttgagatctattaaggcctgttctggctatttggttggt
ggagcttctttaaaagcaaagaatttcattgaaattattaagaattattataattag

DBGET integrated database retrieval system