KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01088Help
Entry
SAR11G3_01088     CDS       T01465                                 

Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Brite
Enzymes [BR:pel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SAR11G3_01088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960858..961514
Genome map
AA seq 218 aa AA seqDB search
MKFENQRNEMVESQLRPNLVLNENILQAFGTVKREKYFSTKLQSISYMDDNIFINDERFV
LRPFVLGKLISNLDIGLDKNVLDVGSTNGYSSSILSYLFKKVVSLEDNDTCADLITKTCK
GENLQNIKVIKNSFLETENLKSTFDSILINGEVDSNPINLIKLLKLNGKLVTIFRDGRSS
YACMYIKKENNTFDKLRIFDASSPALINYKSKEPVFTF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaatcaaagaaatgaaatggttgaaagccaattaagaccaaatctggtg
cttaatgaaaatattttacaagcatttggcactgtaaaacgtgaaaagtatttttcaacg
aaactccagtcaatttcttacatggacgacaatatttttataaatgatgagaggtttgtt
ttacgaccttttgtattaggaaaattaatatcaaacttggatattggattagataaaaat
gttttagatgtaggttcaaccaatggatatagctcttctatcctttcctatctttttaaa
aaagttgtcagtcttgaagataatgacacatgcgctgatcttattacaaaaacatgtaaa
ggtgaaaatttacaaaacattaaggttattaaaaactcctttttagaaactgaaaattta
aaatcaacttttgatagcattttaataaatggagaggtggattcaaatccaataaattta
ataaagttattaaaattaaatggaaagctagttactatatttagagatggtagaagttca
tatgcatgtatgtatatcaaaaaagaaaataacacttttgataaattgagaatttttgat
gcctcttctcccgctcttattaattacaaaagcaaagagcctgtttttaccttttaa

DBGET integrated database retrieval system