KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01097Help
Entry
SAR11G3_01097     CDS       T01465                                 

Definition
beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pel00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pel00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971302..972255
Genome map
AA seq 317 aa AA seqDB search
MTKLVRPVILGIEGSRISKKEYFLFKKYPPLGYIIFSRNIENFSQLKNLITELRSINHYN
NTLIMIDHEGGRVNRFSKFFSQSKYSAKNFGLTYENNKKEFFKNLNKFINFNSNLFNYLG
INLVAAPTLDLFYKNKSDVIGDRSYSSKVEVVQAIGKLVIDMYKKKKILTIAKHVPGHGL
STEDSHFYLPVIKNKLSFLKKNDLACFRNVKSNFLMTAHIVYEGIDKNNPATLSKKLIND
LIRKQLNFKGLLMSDDICMKALKGSPQTLANKSFAAGCDIVLHCNGDYNQMLSLLESVRP
ASSSLLAKIIKLFDYTR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttagttaggcctgtaattctcggtatagaaggatcgcgaatttccaaaaaa
gaatattttttatttaaaaaatacccacctttgggatatataattttttctagaaacata
gaaaatttttcacagttaaaaaatttaattacggagctgagatctattaatcactataat
aatacattaataatgattgatcatgaaggaggaagagtaaacagattctctaaatttttt
agccaatctaaatattctgcaaaaaattttggtcttacatacgaaaataataaaaaagaa
ttttttaaaaatctaaacaaatttatcaattttaattcaaatctatttaattatttggga
attaatctagtagcagcaccaactttagatttgttttataaaaacaaatcggatgtaatt
ggcgacagatcctattcaagcaaagttgaagttgttcaggctattggaaaattagttatt
gatatgtataagaaaaaaaaaatcttaactatagcgaagcacgttccgggccatggatta
tcaaccgaagattctcatttttacttacctgtaataaaaaataaattaagcttcttaaaa
aaaaatgatctagcctgttttcgtaacgttaagtcaaattttttaatgacagctcatata
gtctatgagggtattgacaagaataacccagcaaccctctccaaaaagcttattaacgat
ttaatacgcaaacaattaaattttaaaggccttttaatgtccgatgatatttgcatgaag
gcactaaaggggtctccacagactttggcaaacaaatcttttgcagcaggttgtgatatc
gttcttcattgtaacggtgattataatcaaatgcttagtttgttagaaagcgtgagacca
gcaagtagctctttgttagcaaaaattattaaattgtttgattatacaagataa

DBGET integrated database retrieval system