KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01097Help
Entry
SAR11G3_01097     CDS       T01465                                 

Definition
beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11G3_01097
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SAR11G3_01097
Enzymes [BR:pel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAR11G3_01097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971302..972255
Genome map
AA seq 317 aa AA seqDB search
MTKLVRPVILGIEGSRISKKEYFLFKKYPPLGYIIFSRNIENFSQLKNLITELRSINHYN
NTLIMIDHEGGRVNRFSKFFSQSKYSAKNFGLTYENNKKEFFKNLNKFINFNSNLFNYLG
INLVAAPTLDLFYKNKSDVIGDRSYSSKVEVVQAIGKLVIDMYKKKKILTIAKHVPGHGL
STEDSHFYLPVIKNKLSFLKKNDLACFRNVKSNFLMTAHIVYEGIDKNNPATLSKKLIND
LIRKQLNFKGLLMSDDICMKALKGSPQTLANKSFAAGCDIVLHCNGDYNQMLSLLESVRP
ASSSLLAKIIKLFDYTR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttagttaggcctgtaattctcggtatagaaggatcgcgaatttccaaaaaa
gaatattttttatttaaaaaatacccacctttgggatatataattttttctagaaacata
gaaaatttttcacagttaaaaaatttaattacggagctgagatctattaatcactataat
aatacattaataatgattgatcatgaaggaggaagagtaaacagattctctaaatttttt
agccaatctaaatattctgcaaaaaattttggtcttacatacgaaaataataaaaaagaa
ttttttaaaaatctaaacaaatttatcaattttaattcaaatctatttaattatttggga
attaatctagtagcagcaccaactttagatttgttttataaaaacaaatcggatgtaatt
ggcgacagatcctattcaagcaaagttgaagttgttcaggctattggaaaattagttatt
gatatgtataagaaaaaaaaaatcttaactatagcgaagcacgttccgggccatggatta
tcaaccgaagattctcatttttacttacctgtaataaaaaataaattaagcttcttaaaa
aaaaatgatctagcctgttttcgtaacgttaagtcaaattttttaatgacagctcatata
gtctatgagggtattgacaagaataacccagcaaccctctccaaaaagcttattaacgat
ttaatacgcaaacaattaaattttaaaggccttttaatgtccgatgatatttgcatgaag
gcactaaaggggtctccacagactttggcaaacaaatcttttgcagcaggttgtgatatc
gttcttcattgtaacggtgattataatcaaatgcttagtttgttagaaagcgtgagacca
gcaagtagctctttgttagcaaaaattattaaattgtttgattatacaagataa

DBGET integrated database retrieval system