KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01124Help
Entry
SAR11G3_01124     CDS       T01465                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pel00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pel00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(993780..994334)
Genome map
AA seq 184 aa AA seqDB search
MPSIKKTLIVSIIMLSFFSSKVSSKSDQTVYNFSFNDIQEKKYLLSQHKGKVLMVVNVAS
QCGFTKQYEDLQKLHEEYKDKGLVLIGIPSNDFGNQEPGSNKEIKNFCESNFGITFPIMG
KTSVIGKNQHPFYKWVKDNYGKSGVPKWNFYKVLINKDGHVEEVYSSLTKPKSSKIIKKL
NKVL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtattaaaaaaacacttattgtatcaataattatgttatctttttttagttca
aaagtttcttcaaaatctgatcaaaccgtttacaatttttcttttaacgacattcaagaa
aaaaaatatcttctaagtcagcacaaaggaaaggttttgatggttgtcaatgtagctagc
caatgtggttttacaaaacaatatgaagatcttcaaaaactccatgaagaatataaagat
aaaggattagttttgataggaataccatcaaatgattttggaaatcaagagcctggaagt
aataaagaaataaaaaatttttgtgaaagtaattttggaattacatttccaattatggga
aaaacttctgttattggtaaaaaccaacatccattttacaagtgggtaaaagataattat
ggaaaatctggagtacctaaatggaatttttacaaagtattgattaacaaagatggtcac
gtagaagaagtgtacagttcacttacaaagcccaaaagttcaaaaataattaagaaatta
aataaagttttataa

DBGET integrated database retrieval system