KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01162Help
Entry
SAR11G3_01162     CDS       T01465                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAR11G3_01162
Enzymes [BR:pel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SAR11G3_01162
Exosome [BR:pel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR11G3_01162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029960..1030436
Genome map
AA seq 158 aa AA seqDB search
MDGRIGEIRKSLEKNNFPNTILLSYAAKFASNFYGPFRNAISSSAKLKTDKKNYQMDFHN
SDESLREVLLDISEGADMVMIKPGLAYLDIISKVKEKYKIPVIAYNVSGEYSMIKHAIQN
KIMGDDAIYETMVSFKRAGASAIVTYFANEIVEKFIDI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggatggaagaattggagaaatacgaaaatcattagaaaaaaataattttccaaacact
attcttttgtcatacgctgccaaatttgcttcaaatttttatggaccttttagaaatgcg
atctcaagtagtgctaaattgaaaactgataaaaaaaattatcaaatggattttcacaat
tctgatgaatctttgcgagaagtgttgcttgatatatctgaaggtgcagacatggtaatg
atcaagcctgggttggcttatctagatataatttcaaaagttaaagaaaagtacaaaata
cctgtgattgcttacaatgtgtctggcgaatattctatgataaaacatgcaattcaaaat
aaaattatgggtgatgatgctatatatgaaactatggtgtcattcaaaagagctggggcc
agtgcaattgttacttattttgcaaacgagatagttgaaaaatttatagatatttaa

DBGET integrated database retrieval system