KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01174Help
Entry
SAR11G3_01174     CDS       T01465                                 

Definition
tmRNA-binding protein SmpB
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR11G3_01174
Enzymes [BR:pel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SAR11G3_01174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1039442..1039945)
Genome map
AA seq 167 aa AA seqDB search
MIYLAFGSNLKSKFGCSTFVINKAYRELEKFGIRILSKSSFYKSKAYPNPKDPEFVNSVI
LANSEIHATKLLNIILKIEKKFGRVRSLKNAPRTIDIDIIDFRSKNISILNKKVNLTIPH
NSLESRLFVLKPLAEINPYWKNPRTGVIIPFLIKKIKCLKDNKITKI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatttatttggcattcggctccaatctaaaatcaaaatttgggtgttccaccttcgtt
attaataaagcttacagagagttagaaaaatttggaattcggattctaagcaagtcatct
ttttataaatcaaaagcgtatccaaaccctaaggatcctgaatttgtgaattcagtaata
ttagcgaattcagaaattcatgcgacaaagctactaaatataattttaaagatagaaaaa
aaattcggaagggttagatctctcaaaaatgctccaagaactatagatatagatataatt
gattttcgttctaaaaatataagtattttaaacaaaaaagtaaatttaactattcctcac
aatagcttggaaagcagactttttgtattgaagcctctggcagaaataaacccttattgg
aaaaaccctagaacaggagttattataccttttttgataaaaaaaataaaatgtcttaaa
gacaataagattactaagatataa

DBGET integrated database retrieval system