KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01186Help
Entry
SAR11G3_01186     CDS       T01465                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pel00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pel00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049695..1050645
Genome map
AA seq 316 aa AA seqDB search
MATNKLQAIKFNHTHLLGIQYLSIPEVNLILDESLAFVDLNRQENKKLKILNGKTQINLF
FENSTRTLSSFELAGKRLGADVMNMNVAQSAIKKGETLIDTAMTLNAMHPDILVIRHQDS
GAANLLSQKVNCSVINAGDGRREHPTQALLDAMTIRMKKGKIEGLRVAICGDILHSRVAR
SNIYLLNMLGAEVRVIGPSTLMPKYIEGFGVKSFTNMEEGLEGCDIIMMLRMQTERMDGS
YMPSTREYYEFFALDYKKIKNAKSDALIMHPGPMNRGIEIDTNLADDINRSIIVQQVEMG
VAVRMAVLKILMEAKQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaacaaacttcaagctattaaatttaatcacacacatcttttaggtatccaa
tatttatccattcccgaagttaatcttatattagatgaatctttggcttttgttgatctc
aacagacaagaaaacaaaaaattaaagattttaaatggaaagactcaaatcaacttattc
tttgaaaattccactagaacattaagctcatttgaattagctggaaaaagacttggtgct
gatgttatgaatatgaatgttgcacagtcagcgattaaaaagggagaaactttaatcgac
acagctatgactttgaatgcgatgcatcctgatattttggttattagacatcaagactca
ggtgctgcaaaccttctttctcaaaaagtaaattgctctgtaataaatgctggagacggt
cgtagagaacaccccacccaagctttattggatgcaatgacaattagaatgaaaaaagga
aaaatagaaggactccgtgtagctatttgtggagatattttgcactctagagtagctaga
tctaatatttatttattaaatatgcttggtgctgaggttagagttattggcccctcaact
ttaatgccaaaatatattgagggatttggtgtcaaatcttttactaatatggaggagggt
ctggagggttgtgacataattatgatgttaagaatgcagaccgaaagaatggatgggtct
tacatgccctctacgagagaatattatgaattttttgcacttgattataaaaaaattaaa
aatgcaaaatcagatgctttgattatgcatccaggccctatgaacagaggaatagaaatt
gatactaatctagcagatgacatcaatagaagcatcatagtacagcaagttgagatggga
gttgccgtacgaatggctgttcttaaaattttaatggaagctaagcaatga

DBGET integrated database retrieval system