KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01194Help
Entry
SAR11G3_01194     CDS       T01465                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pel00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pel00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pel00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pel00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1059563..1060324)
Genome map
AA seq 253 aa AA seqDB search
MLPLTKAFPKELWPLGKTSILERVLKECDEAGIKEVFLVISKRKSIIKKYFDKDRELEKR
ILNNKKAIKKINILKKYQKKIKFVYQNSAKGLGDAVNACRKKIISDHFLLILPDDIIIKK
NCSRELVSIHKAYKSSVVATKIVQKKDVDRYGILGFSKKNKSILDINKFVEKPKISLAPS
KYAIIGRYILSKKIFKFLNKSKKGKHGEVQITDAMNKLLISGEKFNGSIFKGSYLDCGTM
DGYIESFNKIGNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgttacctttaacgaaagctttccccaaagagctttggcctttaggaaaaacatctatt
ttagaaagagttttaaaagaatgtgatgaagcaggcattaaagaagtgtttttagtgatt
tcaaaacgaaaaagtattataaaaaaatactttgataaagatcgcgaactagaaaaaaga
atcttaaataataaaaaagcaattaaaaaaataaatattcttaaaaagtatcaaaaaaag
ataaaatttgtttatcaaaattctgcaaaaggattaggtgatgcggtaaatgcgtgtcgt
aaaaaaataatatcagatcattttttactaattttgcccgatgacataataattaagaag
aattgtagccgtgaattagttagtatacacaaagcttacaagtcatcagttgttgcgacc
aagattgttcagaaaaaagacgttgataggtatggaattttaggattttctaaaaaaaat
aagagtatactcgatattaataaatttgttgaaaaacctaaaatttctctagcaccttca
aaatacgctattattggcaggtatattttaagtaaaaaaatatttaagtttctaaataaa
agcaaaaaaggtaagcatggagaagttcaaattaccgatgcaatgaataagctcttgatt
agtggtgaaaaatttaatggatctatttttaaaggatcgtatttggactgtggaactatg
gatggttatattgaatcattcaataaaataggcaattattaa

DBGET integrated database retrieval system