KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01194Help
Entry
SAR11G3_01194     CDS       T01465                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
pel00040  Pentose and glucuronate interconversions
pel00052  Galactose metabolism
pel00500  Starch and sucrose metabolism
pel00520  Amino sugar and nucleotide sugar metabolism
pel01100  Metabolic pathways
pel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAR11G3_01194
   00052 Galactose metabolism
    SAR11G3_01194
   00500 Starch and sucrose metabolism
    SAR11G3_01194
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11G3_01194
Enzymes [BR:pel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAR11G3_01194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Glycos_transf_2 NTP_transf_3 ResIII
Motif
Other DBs
NCBI-ProteinID: AEA81669
UniProt: F2I1F5
Position
complement(1059563..1060324)
Genome map
AA seq 253 aa AA seqDB search
MLPLTKAFPKELWPLGKTSILERVLKECDEAGIKEVFLVISKRKSIIKKYFDKDRELEKR
ILNNKKAIKKINILKKYQKKIKFVYQNSAKGLGDAVNACRKKIISDHFLLILPDDIIIKK
NCSRELVSIHKAYKSSVVATKIVQKKDVDRYGILGFSKKNKSILDINKFVEKPKISLAPS
KYAIIGRYILSKKIFKFLNKSKKGKHGEVQITDAMNKLLISGEKFNGSIFKGSYLDCGTM
DGYIESFNKIGNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgttacctttaacgaaagctttccccaaagagctttggcctttaggaaaaacatctatt
ttagaaagagttttaaaagaatgtgatgaagcaggcattaaagaagtgtttttagtgatt
tcaaaacgaaaaagtattataaaaaaatactttgataaagatcgcgaactagaaaaaaga
atcttaaataataaaaaagcaattaaaaaaataaatattcttaaaaagtatcaaaaaaag
ataaaatttgtttatcaaaattctgcaaaaggattaggtgatgcggtaaatgcgtgtcgt
aaaaaaataatatcagatcattttttactaattttgcccgatgacataataattaagaag
aattgtagccgtgaattagttagtatacacaaagcttacaagtcatcagttgttgcgacc
aagattgttcagaaaaaagacgttgataggtatggaattttaggattttctaaaaaaaat
aagagtatactcgatattaataaatttgttgaaaaacctaaaatttctctagcaccttca
aaatacgctattattggcaggtatattttaagtaaaaaaatatttaagtttctaaataaa
agcaaaaaaggtaagcatggagaagttcaaattaccgatgcaatgaataagctcttgatt
agtggtgaaaaatttaatggatctatttttaaaggatcgtatttggactgtggaactatg
gatggttatattgaatcattcaataaaataggcaattattaa

DBGET integrated database retrieval system