KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01246Help
Entry
SAR11G3_01246     CDS       T01465                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pel00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pel00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102661..1103155)
Genome map
AA seq 164 aa AA seqDB search
MPIEKYPEKVWRKMIDINLTTPFLFTKELLPVMRKNKWGRIVNIASTHGLIGSVNKSAYT
ASKHGLVGLTKVTALETAKDPITCNSLCPGFVLTELIQDQIKAVAKNKNIPFLDARVEML
RDKQPSLKFVRKEDIASMIFFLCSQEADQVTGSNISLDGAWTAQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgaaaagtatccagaaaaggtttggagaaagatgatagatattaatcttaca
actccttttctattcacaaaggagctattgcccgttatgagaaaaaataaatggggcaga
attgttaacatagcttctacccacggcttaattggctcggtaaataaatctgcttacaca
gcttctaagcatgggttggttggattaacaaaagtaacagctctagaaactgcaaaagat
ccaattacatgtaactctttatgtccaggctttgtccttacggaactaatccaagatcaa
attaaagcagttgcaaaaaacaaaaatattccatttcttgatgctagggtagaaatgtta
agagataagcaaccttcattaaaattcgttagaaaagaggatatagcatcaatgatattt
tttttatgttctcaggaagctgatcaagttactggatcaaatatttcgctagacggggca
tggacagcacaatga

DBGET integrated database retrieval system