KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01246Help
Entry
SAR11G3_01246     CDS       T01465                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SAR11G3_01246
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SAR11G3_01246
Enzymes [BR:pel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SAR11G3_01246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102661..1103155)
Genome map
AA seq 164 aa AA seqDB search
MPIEKYPEKVWRKMIDINLTTPFLFTKELLPVMRKNKWGRIVNIASTHGLIGSVNKSAYT
ASKHGLVGLTKVTALETAKDPITCNSLCPGFVLTELIQDQIKAVAKNKNIPFLDARVEML
RDKQPSLKFVRKEDIASMIFFLCSQEADQVTGSNISLDGAWTAQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgaaaagtatccagaaaaggtttggagaaagatgatagatattaatcttaca
actccttttctattcacaaaggagctattgcccgttatgagaaaaaataaatggggcaga
attgttaacatagcttctacccacggcttaattggctcggtaaataaatctgcttacaca
gcttctaagcatgggttggttggattaacaaaagtaacagctctagaaactgcaaaagat
ccaattacatgtaactctttatgtccaggctttgtccttacggaactaatccaagatcaa
attaaagcagttgcaaaaaacaaaaatattccatttcttgatgctagggtagaaatgtta
agagataagcaaccttcattaaaattcgttagaaaagaggatatagcatcaatgatattt
tttttatgttctcaggaagctgatcaagttactggatcaaatatttcgctagacggggca
tggacagcacaatga

DBGET integrated database retrieval system