KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01287Help
Entry
SAR11G3_01287     CDS       T01465                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11G3_01287
   00030 Pentose phosphate pathway
    SAR11G3_01287
   00051 Fructose and mannose metabolism
    SAR11G3_01287
   00052 Galactose metabolism
    SAR11G3_01287
   00500 Starch and sucrose metabolism
    SAR11G3_01287
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11G3_01287
  Nucleotide metabolism
   00230 Purine metabolism
    SAR11G3_01287
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR11G3_01287
Enzymes [BR:pel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SAR11G3_01287
    5.4.2.8  phosphomannomutase
     SAR11G3_01287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1139038..1139817
Genome map
AA seq 259 aa AA seqDB search
MLHAIAKAVKENNADVGFGFDGDGDRVGVIDNLGEEIFSDKIGLLIARNLAPKHKGSKFI
VDVKSTGLFAHDKVLQEHNCETVYWKTGHSHIKRKVNKEKALAGFEKSGHFFFNQPLGFG
YDDGINSAIQVCHLLDHQDKKMNDLINELPKTYQTPTMAPFCKDEEKYKVVEDLVKQVED
LKKTTKIDGQAITDVLTVNGVRFSLEDGSWGLIRASSNKPSLVVVTESPTSDERKKKIFD
FIDDLLQKTGKIGEYDQKI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatgcgatagcaaaagcggtgaaagaaaataatgcagacgtaggatttggtttt
gatggggatggagaccgtgtaggtgttattgataatttaggtgaagaaatattctcagat
aaaattggacttctgattgcaagaaacctcgctcccaaacataaaggatcaaaatttata
gtcgatgttaagtcaacaggactatttgcccatgataaagtgttacaagaacataattgt
gaaactgtttattggaaaactgggcactctcatattaaaagaaaagtgaataaagaaaaa
gcattagcgggatttgaaaaaagtggtcacttcttttttaatcagccgttaggttttggt
tatgatgatggaattaattctgctattcaagtttgtcacttactggatcatcaagataaa
aagatgaatgatcttataaatgaattgccaaaaacctatcaaactccaaccatggcacct
ttttgcaaagatgaagaaaaatataaagtagttgaagacttggtaaaacaagtagaagat
ttaaaaaaaactactaagatagatggtcaagctatcacggatgtattaacagttaatggt
gttagattttcactagaagatggttcttgggggcttattagagcatcatcaaacaagcct
tctttagtggtggtaacggagagcccaacttcggatgagagaaagaaaaagatttttgat
tttatcgatgatctattacaaaagaccggcaaaattggtgaatacgaccaaaaaatttaa

DBGET integrated database retrieval system