KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01287Help
Entry
SAR11G3_01287     CDS       T01465                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pel00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pel00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pel00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pel00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pel00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pel00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pel00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pel00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1139038..1139817
Genome map
AA seq 259 aa AA seqDB search
MLHAIAKAVKENNADVGFGFDGDGDRVGVIDNLGEEIFSDKIGLLIARNLAPKHKGSKFI
VDVKSTGLFAHDKVLQEHNCETVYWKTGHSHIKRKVNKEKALAGFEKSGHFFFNQPLGFG
YDDGINSAIQVCHLLDHQDKKMNDLINELPKTYQTPTMAPFCKDEEKYKVVEDLVKQVED
LKKTTKIDGQAITDVLTVNGVRFSLEDGSWGLIRASSNKPSLVVVTESPTSDERKKKIFD
FIDDLLQKTGKIGEYDQKI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatgcgatagcaaaagcggtgaaagaaaataatgcagacgtaggatttggtttt
gatggggatggagaccgtgtaggtgttattgataatttaggtgaagaaatattctcagat
aaaattggacttctgattgcaagaaacctcgctcccaaacataaaggatcaaaatttata
gtcgatgttaagtcaacaggactatttgcccatgataaagtgttacaagaacataattgt
gaaactgtttattggaaaactgggcactctcatattaaaagaaaagtgaataaagaaaaa
gcattagcgggatttgaaaaaagtggtcacttcttttttaatcagccgttaggttttggt
tatgatgatggaattaattctgctattcaagtttgtcacttactggatcatcaagataaa
aagatgaatgatcttataaatgaattgccaaaaacctatcaaactccaaccatggcacct
ttttgcaaagatgaagaaaaatataaagtagttgaagacttggtaaaacaagtagaagat
ttaaaaaaaactactaagatagatggtcaagctatcacggatgtattaacagttaatggt
gttagattttcactagaagatggttcttgggggcttattagagcatcatcaaacaagcct
tctttagtggtggtaacggagagcccaacttcggatgagagaaagaaaaagatttttgat
tttatcgatgatctattacaaaagaccggcaaaattggtgaatacgaccaaaaaatttaa

DBGET integrated database retrieval system