KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_01344Help
Entry
SAR11G3_01344     CDS       T01465                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pel00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SAR11G3_01344
Enzymes [BR:pel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SAR11G3_01344
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SAR11G3_01344
Lipid biosynthesis proteins [BR:pel01004]
 Fatty acid synthase
  Component type
   SAR11G3_01344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193651..1194175)
Genome map
AA seq 174 aa AA seqDB search
MAGYGLPKEQQLSMVLEKNLQKKGYNIKIINGSVSGSTSSGGLNRVKWTLEEPNIDLLIL
GLGANDMLRGIDPQETKKNLDNIIQIAQGKNIKIILAGMLAPTTHGIGYKKNFDRIYPSL
ATQYKLPLIPFLLEGVAMKPELNQSDGIHPNREGTVVMSVTLEKSIIRFIKKKY
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatacggtttgccaaaagaacagcaattatcaatggtccttgaaaagaatctt
caaaaaaaaggttataatatcaaaattattaatggcagtgtttctggaagcacctcttcg
ggtggactgaatagagttaaatggactttagaagaacctaatattgatttattgatttta
ggattgggtgccaatgatatgttacgaggtattgaccctcaagaaacaaaaaaaaattta
gataatattattcaaattgcacaaggcaaaaatattaaaataatcttggccggaatgctg
gctcctaccactcatggaataggctataaaaaaaactttgatcgaatttatccttcttta
gccactcaatataaattgcctcttattcctttcttattagaaggagttgcaatgaaacct
gagcttaatcaaagcgatggtattcatccaaacagggaaggtaccgtcgttatgagcgta
accttagaaaaaagtattattagatttattaagaaaaaatactag

DBGET integrated database retrieval system