KEGG   Pseudomonas entomophila: PSEEN0038Help
Entry
PSEEN0038         CDS       T00362                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pen  Pseudomonas entomophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEEN0038 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEEN0038 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSEEN0038 (trpB)
Enzymes [BR:pen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSEEN0038 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(39214..40431)
Genome map
AA seq 405 aa AA seqDB search
MTQTQYRAGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLIACVG
GGSNAMGLFHDFLDDASVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDDDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVICLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacccaataccgcgccggccccgatgccaacggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgcccctggtgctggacctggcccgcgaatacgaa
gccgccaaggccgaccccaagttcctcgaagaactcgcctacttccagcgcgactacatc
ggccgccccaacccgctgtacttcgccgagcgcctgaccgagcactgcggcggcgcgaag
atcttcttcaagcgtgaagagctcaaccacaccggcgcgcacaaggtgaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaagaaacgcctgatcgccgagaccggcgcc
ggcatgcacggtgtggccaccgccaccgtcgccgcgcgcttcggcctgccttgcgtgatc
tacatgggtgccaccgacattgagcgccagcaggccaacgtgttccgcatgaagctgctg
ggcgccgagatcgtcccggtcaccgccggcaccggcaccctcaaggacgccatgaacgag
gccctgcgcgactgggtcaccaacgtcgaggacaccttctacctgatcggcaccgtggcc
ggcccgcacccgtacccggcgatggtccgcgacttccagtcgatcatcggcaaggaaacc
cgcgcccagctgcaggagaaggaagggcgcctgcccgacagcctgatcgcctgcgtcggc
ggcggctccaatgccatgggcctgttccacgacttcctcgatgatgccagtgtgcagatc
atcggcgtcgaagccggcggtcacggcgtgcacaccgacaagcacgcggccagcctcaac
ggcggcgtgccgggcgtactgcacggcaaccgcacctacctgctgcaggacgacgacggc
cagatcaccgacgcccactcgatctcggcaggcctggactaccctggcatcggcccggag
cacgcctacctgcatgaagtgaagcgtgtggagtacgtcagcatcaccgacgacgaagca
ctcgacgccttccacgccacctgccgcctggaaggcatcatcccggcgctggaaagctcc
cacgccctggccgaggcgatcaagcgcgcgccgaagctgcccaaggaccacctgatggtg
atctgcctgtccggtcgcggcgacaaggacatgcaaaccgtgatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system