KEGG   Pseudomonas entomophila: PSEEN0083Help
Entry
PSEEN0083         CDS       T00362                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pen  Pseudomonas entomophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78299..80284
Genome map
AA seq 661 aa AA seqDB search
MTEEAERWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAEGSDKIVDQCMKEMRE
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMTQVSDALTALVTQLQTLPLPGEVARPL
KKLAKKLDGGVSQSRELPPLLGELSGLQGRALNAVQKPDEEARPGFLQRLFGGRDEPQAE
MATTAVAVTSPALAPVPAEAPAVQPTLPQDADELHALNVVPAPAVEEEPEPEPDIELPGP
ALVETVAVIPVAPAPVPEPEPAPVVEEAPAPELASVEPEEQPAEDVEPAQLPALADIIEG
EDGPYALPDAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELI
PVLDDLAVLMLAITDSGQHEFEAYLQQLNERLETFQSHLHEASAGHADNSSAARELDNQL
REQVDGLQSSVQGAADVDSLKHILENRLEGLLVTMDEHQHERDRREQELAGRLQGLAERV
ASMEQEALGYREHLEEQRQKAMIDPLTGLPNRAAWSERVEHEVLDWQENGGHLAMAILDL
DHFKRINDGYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTSPPAAVQVA
ETLRAAIEACPFHFKGERVVITASIGISAFRSGERGDQVLKRADDALYRAKDKGRNRIEQ
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaagccgagcgctggaaagaaaaataccttaaaagcatcgaacagcaggaa
aagctcgaacggcgctgggccgctcgtctcgacttgctgcgtcgtggcctggtgcgcagc
accctggcggccgaaggtagcgacaagatcgttgaccagtgcatgaaggaaatgcgcgag
gtcatccgcagcgacaatatggacgccgggcttgccgggctgatcccacgcctggaaaag
gccgtgctcgactccgagcaacgccgtgaaacgcgcatgacccaggtcagcgacgcgctg
actgcgctggtgactcaattgcagacgctgcccctgcctggggaagtggcgcgcccgctg
aagaagctggcgaagaaactggatggcggcgtcagccagtcccgtgaactgcctccgctg
ctgggcgagctcagcggcttgcaggggcgcgccctcaacgcggtgcaaaagcctgacgag
gaagccaggccggggtttctccagcgcctgttcggcgggcgtgacgagcctcaggccgag
atggccacgacggctgtcgcagtgacgtctccggcgctcgcaccggtccctgccgaggct
cccgcggtacaacccaccctgcctcaggatgcggacgaactgcatgccctgaacgttgtg
cctgcgcctgcggtggaggaagagcccgaacctgagccggacatcgagctaccaggcccc
gcgctggtcgaaaccgtcgcggtgattcctgtcgcgcctgcgcctgtgccggagcctgag
cccgccccggtagtcgaggaagcaccagcgcccgaacttgccagtgtcgagcccgaggag
caacccgccgaagacgtcgagccggcacaactccctgcgctcgcggatatcatcgaggga
gaagacggcccctacgccctccccgatgcggtcgagcccccgtacagtcaggtggcggcc
catatcgagcagaccctgatcggcctgctcgacgacctcagcctgcccgagcgccacaag
gcccaggccctggagatgcgcgaacgcgttgcccgcggccttaactggtacgagttgatc
ccggtgctggacgacctggccgtgctcatgctggccattaccgacagcggccagcacgag
ttcgaagcctatctgcagcaactcaacgagcgcctggaaaccttccagagccacctgcac
gaagccagtgccggccacgccgacaacagctccgccgcccgtgagctggacaaccagttg
cgcgagcaggtcgatggcctgcagagcagtgtccagggcgccgccgacgtggacagcctc
aagcacatcctggagaaccgtctcgagggtttgctggtgaccatggatgaacaccagcat
gagcgtgaccgtcgtgaacaggagctggctggccgtctgcaagggttggccgagcgggtg
gcgagcatggagcaggaagccctcggctaccgcgagcacctcgaggagcagcggcagaag
gcgatgatcgatcccctcacgggcctgcccaaccgcgccgcctggtcggagcgggtcgag
catgaagtgctcgactggcaggagaacggcgggcacctggccatggccattctcgacctc
gaccacttcaagcgcatcaacgacggttatggccacctggccggcgacaaggtgctgaag
atcgtcgccgaccagttgcgcaagcgtctgcgcggccgcgacttcatcgcccgtttcggc
ggcgaggagttcgtcctgctgttgccgcagacttcgcctcccgcggcggtgcaggtcgcc
gagacgctgcgcgcggcgatcgaagcctgcccgttccacttcaagggcgagcgcgtggtg
attaccgcgtccattggtatcagcgccttccgctccggtgagcgtggcgaccaagtgctc
aagcgcgcggatgatgcactgtatcgggccaaggacaaaggacgaaaccgcatcgaacag
gggtag

DBGET integrated database retrieval system