KEGG   Pseudomonas entomophila: PSEEN0191Help
Entry
PSEEN0191         CDS       T00362                                 

Gene name
gabT
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pen  Pseudomonas entomophila
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSEEN0191 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEEN0191 (gabT)
   00310 Lysine degradation
    PSEEN0191 (gabT)
Enzymes [BR:pen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSEEN0191 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PSEEN0191 (gabT)
Amino acid related enzymes [BR:pen01007]
 Aminotransferase (transaminase)
  Class III
   PSEEN0191 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199266..200543
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLERSQAVGERLTAGLKQIQAKHPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVAQVVAKARDKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgatgcaacgccgtgtcgccgccgtcccacgtggcgtc
ggtcaaattcacccgatcttcgttgatactgcgaagaactcgacggtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcggtactgaacaccggccacctgcac
ccgaaagtggtcgcggctgtgcaagagcagctgaccaaggtcagccacacctgcttccag
gtgctggcctatgagccgtacgtcgagctgtgcgaaaagatcaacgcccgtgtaccaggc
gacttcgccaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtg
aagatcgcccgtgccgccactggccgtgctggcgtgatcgccttcaccggcggctaccac
ggccgcaccatgatgaccctgggcctgaccggtaaggtcgtaccgtactccgcgggcatg
ggcctgatgccaggtggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gtcgatgacgccatcgcctcggtcgagcgcatcttcaagaacgacgccgagccgcgcgat
atcgccgcgatcatccttgagccagtacaaggcgaaggcggcttcctgccagcgccgaaa
gaactgatgaagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgctggccgtaccggcaccttcttcgccatggagcagatgggcgtc
gcgcctgacctgaccaccttcgccaagtccatcgccggcggcttcccgctggccggtgtg
tgcggcaaggccgagtacatggacgccatcgccccgggcggcctgggcggcacctatgcc
ggttcgccgatcgcctgcgccgcggccctggccgtgatcgaagtgttcgaggaagagaag
ctgctggagcgtagccaggctgttggcgagcgtctgaccgctggcctcaagcagatccag
gccaagcacccgatcatcggcgacgtccgtggtctgggttcgatgatcgcggtggaagtc
ttcgagaaaggcacccacaccccgaacgccgctgccgttgcacaggtcgtggccaaggcg
cgcgacaagggcctgatcctgctgtcctgcggtacctacggcaacgtcctgcgcatcctg
gtgccgctgaccgccgaagacgcactgctggacaaaggcctggcaatcatcgaagagtgc
ttcgctgagctggcctga

DBGET integrated database retrieval system